Protein Family IF00957

Metagenome Isolate
220 Members
168 Samples
74 Scaffolds
525.8 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10003099|CVPL010W_1000309917
Length
634 aa
Sequence
MTTGSDFRLTGDMLIGFSSVRGNAGSQRALNPATHSEIADPVFGMGDAQHVEQAARLAAQAFDTYRNLPLARRAAFLEAIAANIEDIGDALIDRAHAETGLPIARLQGERGRTVGQLRLFAKVVRDGHFLNATVDTAQPERTPLPRADLRLVNIPLGPVVVFGASNFPLAFSVAGGDTASALAAGAPVIVKAHSAHPGTCELVGRAIQKAVQDQGLPEGVFSLLFGAGRTLGEALVAHPAIKAVGFTGSRQGGLAILRIANARPEPIPVYAEMSSINPVFLLPAALASRAEKIAAAFADSLTMGAGQFCTNPGLILAVDGADLARFIQAAMLTPGIHAAYTDATAQVDSVAGVAKVAQGLGAGDQPNAAQAALYVTDAARLLATPQLLSEMFGPAAIVVRARSQEELLQVAEHLEGQLTATLQLDAADHAAAQQLLPVLERKAGRILANGFPTGVEVCHAMVHGGPFPSTSNAMFTSVGATAIARFLRPVCYQDLPEALRPAALQDANPLGLRRMTDGDHIRAGEERRPGGQRRSRRVCQRHYVVHTWLPSPAQQYGTGLLSDKCDHTSRPGNFQHASLACQYRPVRACGRRSGRKIREDRAPDAGRTGVRRPEKPVAGGRGRARAALYPAGA*

πŸ“Š Sample Types

Isolate 65.9%
Metagenome 34.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 50.3%
Anthocoridae 8.3%
Culicidae 6.4%
Curculionidae 5.1%
Unclassified 5.1%
Formicidae 4.5%
Elmidae 3.8%
Armadillidiidae 3.8%
Apidae 2.5%
Cerambycidae 1.9%
Termitidae 1.9%
Berytidae 1.3%
Largidae 1.3%
Alydidae 1.3%
Drosophilidae 1.3%
Siricidae 0.6%
Crambidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 209
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
2 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
3 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
4 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
5 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
6 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
7 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
8 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
9 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
10 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
11 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
12 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
13 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
14 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
15 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
16 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
17 8052469819 Pseudomonas putida DZ-F23 Isolate
18 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
19 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
20 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
21 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
22 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
23 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
24 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
25 2718217944 Serratia marcescens AS1 Isolate Culicidae
26 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
27 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
28 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
29 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
30 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
31 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
32 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
33 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
34 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
35 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
36 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
37 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
38 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
39 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
40 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
41 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
42 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
43 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
44 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
45 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
46 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
47 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
48 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
49 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
50 2958255616 Serratia marcescens TM Isolate
51 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
52 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
53 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
54 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
57 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
58 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
59 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
60 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
61 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
62 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
63 8102117041 Caballeronia sp. INML3 Isolate Coreidae
64 8102131453 Caballeronia sp. INML5 Isolate Coreidae
65 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
66 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
67 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
68 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
69 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
70 2978161719 Serratia marcescens KZ2 Isolate Apidae
71 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
72 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
73 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
74 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
75 8069748016 Caballeronia sp. LP003 Isolate Coreidae
76 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
77 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
78 8102109360 Caballeronia sp. INML2 Isolate Coreidae
79 8102145433 Caballeronia sp. LP006 Isolate Coreidae
80 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
81 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
82 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
83 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
84 2703719240 Serratia marcescens ano2 Isolate Unclassified
85 2864755708 Massilia timonae S00006 Isolate Elmidae
86 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
87 3006156446 Acinetobacter baretiae B10A Isolate Apidae
88 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
89 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
90 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
91 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
92 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
93 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
94 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
95 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
96 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
97 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
98 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
99 8102102351 Caballeronia sp. INML1 Isolate Coreidae
100 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
101 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
102 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
103 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
104 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
105 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
106 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
107 2937735258 Serratia marcescens KZ11 Isolate Apidae
108 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
109 2978102237 Serratia fonticola AeS1 Isolate Culicidae
110 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
111 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
112 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
113 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
114 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
115 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
116 8023757577 Caballeronia peredens LP006 Isolate Coreidae
117 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
118 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
119 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
120 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
121 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
122 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
123 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
124 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
125 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
126 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
127 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
128 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
129 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
130 2703719239 Serratia marcescens ano1 Isolate Unclassified
131 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
132 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
133 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
134 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
135 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
136 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
137 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
138 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
139 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
140 8004541719 Serratia marcescens KZ19 Isolate Apidae
141 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
142 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
143 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
144 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
145 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
146 8035422605 Pseudomonas monteilii CY06 Isolate
147 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
148 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
149 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
150 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
151 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
152 2603880172 Burkholderiales C Isolate Unclassified
153 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
154 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
155 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
156 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
157 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
158 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
159 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
160 637000219 Pseudomonas entomophila L48 Isolate Unclassified
161 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
162 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
163 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
164 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
165 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
166 8102124461 Caballeronia sp. INML3B Isolate Coreidae
167 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
168 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160442_100084 3300012806 Bacteria 116419
2 Ga0160472_100316 3300012839 Bacteria 48018
3 Ga0160433_100223 3300012846 Bacteria 42423
4 DPO_contig00077 2032320009 Bacteria 49472
5 DPO_contig06335 2032320009 Bacteria 6146
6 DPOL_contig10521 2035918003 Unclassified 8190
7 DPOL_contig16646 2035918003 Unclassified 13262
8 SWWA_contig21926__length_2527___numreads_31 2100351016 Bacteria 2527
9 CVPL010L_1002112 3300002932 Unclassified 3418
10 Ga0102737_1000092 3300007142 Bacteria 27741
11 Ga0466730_055452 3300042625 Bacteria 6156
12 Ga0160464_100052 3300012805 Bacteria 139907
13 Ga0160452_100070 3300012834 Bacteria 137182
14 Ga0160472_100439 3300012839 Bacteria 30779
15 Ga0160433_100014 3300012846 Bacteria 237201
16 SPBB_contig11508 2044078006 Bacteria 176712
17 Ga0103264_1001007 3300007188 Bacteria 12610
18 Ga0103268_1001914 3300007192 Unclassified 4846
19 Ga0466724_14140 3300042649 Bacteria 36535
20 Ga0160470_100937 3300012813 Bacteria 8375
21 Ga0160441_100607 3300012825 Bacteria 22598
22 Ga0160435_1000856 3300012857 Unclassified 8388
23 Ga0466701_023976 3300042598 Bacteria 23279
24 Meta3P_1000404 3300002464 Bacteria 26174
25 CVPL010W_10000310 3300002931 Bacteria 47641
26 Ga0074188_1000430 3300005318 Bacteria 8763
27 Ga0102737_1003384 3300007142 Bacteria 3654
28 Ga0160469_100169 3300012824 Bacteria 66413
29 Ga0160441_101060 3300012825 Bacteria 11292
30 Ga0160444_100077 3300012841 Bacteria 130363
31 Ga0160443_103367 3300012848 Bacteria 2834
32 Ga0466701_044241 3300042598 Bacteria 190116
33 DPOL_contig00408 2035918003 Bacteria 77322
34 SWWA_contig29428__length_84023___numreads_4226 2100351016 Bacteria 84023
35 Meta3P_1000398 3300002464 Bacteria 24268
36 Ga0103264_1003187 3300007188 Bacteria 12898
37 Ga0466724_45022 3300042649 Bacteria 46194
38 Ga0160470_104910 3300012813 Bacteria 1780
39 Ga0160453_100885 3300012814 Bacteria 14871
40 Ga0160467_101223 3300012829 Unclassified 11624
41 Ga0160444_100403 3300012841 Unclassified 22090
42 Ga0160433_100023 3300012846 Bacteria 189127
43 Ga0160433_100065 3300012846 Bacteria 116418
44 Ga0160433_100194 3300012846 Bacteria 49862
45 Ga0160448_104594 3300012854 Unclassified 3805
46 Ga0160457_1000507 3300012858 Bacteria 17099
47 Ga0466701_005142 3300042598 Bacteria 81661
48 Ga0466701_041012 3300042598 Bacteria 318638
49 CVPL010W_10003099 3300002931 Bacteria 26611
50 CVPL005W_1000053 3300002934 Bacteria 43713
51 CVPL005W_1000338 3300002934 Bacteria 21227
52 Ga0160466_100828 3300012809 Bacteria 11704
53 Ga0160440_100912 3300012815 Unclassified 5299
54 Ga0160446_100097 3300012835 Bacteria 83029
55 Ga0160448_100673 3300012854 Bacteria 11523
56 Ga0466701_025086 3300042598 Bacteria 26396
57 SPBB_contig10681 2044078006 Bacteria 147815
58 Ga0102734_1000420 3300007129 Bacteria 12172
59 Ga0466724_20849 3300042649 Bacteria 16503
60 Ga0160466_100141 3300012809 Bacteria 58648
61 Ga0160448_101060 3300012854 Unclassified 9065
62 DPO_contig03928 2032320009 Bacteria 7554
63 DPO_contig07325 2032320009 Bacteria 29497
64 Ga0105005_1032061 3300007505 Bacteria 24375
65 Ga0466724_69469 3300042649 Bacteria 29864
66 Ga0160464_100136 3300012805 Unclassified 80736
67 Ga0160442_100111 3300012806 Bacteria 91568
68 Ga0160469_100447 3300012824 Bacteria 19755
69 Ga0160447_102547 3300012849 Bacteria 6319
70 DPO_contig00097 2032320009 Bacteria 75068
71 SPBB_contig00035 2044078006 Bacteria 249649
72 FGTW_contig30505 2065487013 Bacteria 21168
73 Ga0466730_020561 3300042625 Bacteria 24098
74 Ga0466724_10289 3300042649 Bacteria 7831

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00171 Aldedh Aldehyde dehydrogenase family 26 317 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00171 GO:0016491 oxidoreductase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.