Protein Family IF00936
Metagenome
Isolate
202
Members
43
Samples
199
Scaffolds
328.63
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12952379|JGI24696J40584_129523793
- Length
- 366 aa
- Sequence
- MVKYLTRGMYPSHTIKIQNWSIGVSIKWTSGGQIMEVFKRTALAFSMLALVLPLLTGCQDENSGLITVIFAGTEGATTGQSRMMTESAEILNNSGRFNARVFVSGALGDTDNLVTQARLGVHYVIPSDPGRLASQFNIPDLNILMAPYVLMDPQVLARLPATDIYQEWQAKLELQGVSLVANMFNGFRNFYTTTPVRQLKDLRGLRIRGFGNDIGQALATSLGFTQITMSATEIYPSIQMQALDGAEIQLSTADSYRFFEVAPYLALTRHFMLQSSFVVGTPFLNSMSDEDREFFLQVMYDMAVKWTGIIASEEADYIKNFSNNGGQVFEVDIAEFERAVAPLNENNTLNFTPGLQERLIRELGL*
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
34.1%
Unclassified
14.6%
Termopsidae
7.3%
Rhinotermitidae
7.3%
Hodotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
186
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 6 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 13 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_104727 | 3300042612 | Unclassified | 3176 |
| 2 | Ga0466692_005253 | 3300042591 | Bacteria | 6327 |
| 3 | Ga0466691_015774 | 3300042593 | Bacteria | 8998 |
| 4 | Ga0466719_317638 | 3300042606 | Bacteria | 6565 |
| 5 | Ga0466719_486806 | 3300042606 | Bacteria | 8265 |
| 6 | Ga0466720_073499 | 3300042607 | Bacteria | 6559 |
| 7 | Ga0466722_032020 | 3300042609 | Bacteria | 3237 |
| 8 | Ga0466722_118177 | 3300042609 | Unclassified | 1910 |
| 9 | Ga0466722_153677 | 3300042609 | Bacteria | 2019 |
| 10 | Ga0072941_1001621 | 3300005201 | Bacteria | 12737 |
| 11 | Ga0466735_058122 | 3300042624 | Bacteria | 5896 |
| 12 | Ga0466735_117831 | 3300042624 | Bacteria | 6224 |
| 13 | Ga0466735_149014 | 3300042624 | Bacteria | 2678 |
| 14 | Ga0466703_013530 | 3300042636 | Bacteria | 2646 |
| 15 | Ga0466703_205655 | 3300042636 | Unclassified | 2588 |
| 16 | Ga0466703_254265 | 3300042636 | Bacteria | 1247 |
| 17 | Ga0466704_582695 | 3300042643 | Bacteria | 10525 |
| 18 | Ga0466709_052423 | 3300042648 | Bacteria | 6639 |
| 19 | Ga0466709_200717 | 3300042648 | Bacteria | 7959 |
| 20 | Ga0466709_211856 | 3300042648 | Bacteria | 5829 |
| 21 | Ga0466708_292555 | 3300042652 | Bacteria | 6960 |
| 22 | Ga0466708_426698 | 3300042652 | Bacteria | 3424 |
| 23 | Ga0466727_216089 | 3300042655 | Bacteria | 1974 |
| 24 | Ga0466723_138684 | 3300042618 | Bacteria | 16997 |
| 25 | Ga0466726_013847 | 3300042619 | Bacteria | 5961 |
| 26 | Ga0466726_368565 | 3300042619 | Bacteria | 2662 |
| 27 | Ga0466728_137208 | 3300042620 | Bacteria | 5223 |
| 28 | Ga0466729_064887 | 3300042621 | Bacteria | 38616 |
| 29 | Ga0123353_10082358 | 3300010167 | Bacteria | 5175 |
| 30 | Ga0466696_170017 | 3300042596 | Bacteria | 1434 |
| 31 | Ga0466713_060774 | 3300042602 | Bacteria | 81565 |
| 32 | Ga0466716_283417 | 3300042605 | Bacteria | 15850 |
| 33 | Ga0466720_230770 | 3300042607 | Bacteria | 5242 |
| 34 | Ga0466722_081983 | 3300042609 | Bacteria | 2104 |
| 35 | Ga0466722_208895 | 3300042609 | Bacteria | 2824 |
| 36 | AustNasuHG_c1002955 | 3300000089 | Bacteria | 6123 |
| 37 | Ga0072940_1034749 | 3300005200 | Bacteria | 3837 |
| 38 | Ga0466709_015780 | 3300042648 | Bacteria | 16118 |
| 39 | Ga0466708_003193 | 3300042652 | Bacteria | 37391 |
| 40 | Ga0466727_225230 | 3300042655 | Bacteria | 1225 |
| 41 | Ga0466712_309293 | 3300042614 | Bacteria | 2171 |
| 42 | Ga0466712_322357 | 3300042614 | Bacteria | 13991 |
| 43 | Ga0466711_417211 | 3300042615 | Bacteria | 5229 |
| 44 | Ga0466718_110797 | 3300042617 | Unclassified | 1153 |
| 45 | Ga0466723_101700 | 3300042618 | Bacteria | 4370 |
| 46 | Ga0466726_099474 | 3300042619 | Bacteria | 2727 |
| 47 | Ga0466726_216736 | 3300042619 | Unclassified | 1548 |
| 48 | Ga0466726_258018 | 3300042619 | Bacteria | 17950 |
| 49 | Ga0466726_270448 | 3300042619 | Bacteria | 4341 |
| 50 | Ga0466726_457349 | 3300042619 | Bacteria | 1224 |
| 51 | Ga0466728_121815 | 3300042620 | Bacteria | 6003 |
| 52 | Ga0466728_287091 | 3300042620 | Bacteria | 8300 |
| 53 | Ga0466705_349402 | 3300042612 | Bacteria | 4321 |
| 54 | Ga0466732_419254 | 3300042656 | Bacteria | 18122 |
| 55 | Ga0466690_016087 | 3300042590 | Bacteria | 7289 |
| 56 | Ga0466692_093697 | 3300042591 | Bacteria | 9030 |
| 57 | Ga0466691_061768 | 3300042593 | Bacteria | 11547 |
| 58 | Ga0466706_001128 | 3300042599 | Bacteria | 7687 |
| 59 | Ga0466719_498167 | 3300042606 | Bacteria | 4319 |
| 60 | Ga0466722_061628 | 3300042609 | Bacteria | 14264 |
| 61 | Ga0466722_155579 | 3300042609 | Bacteria | 20338 |
| 62 | JGI24702J35022_10039723 | 3300002462 | Bacteria | 2510 |
| 63 | Ga0466709_063956 | 3300042648 | Bacteria | 51970 |
| 64 | Ga0466711_217973 | 3300042615 | Bacteria | 218633 |
| 65 | Ga0466715_053891 | 3300042616 | Bacteria | 9252 |
| 66 | Ga0466723_027465 | 3300042618 | Bacteria | 52841 |
| 67 | Ga0466723_108878 | 3300042618 | Bacteria | 11537 |
| 68 | Ga0466723_352688 | 3300042618 | Bacteria | 8345 |
| 69 | Ga0466726_021795 | 3300042619 | Bacteria | 1172 |
| 70 | Ga0466726_085899 | 3300042619 | Unclassified | 3326 |
| 71 | Ga0466728_087613 | 3300042620 | Bacteria | 22622 |
| 72 | Ga0466728_408367 | 3300042620 | Bacteria | 5076 |
| 73 | Ga0466728_417430 | 3300042620 | Bacteria | 9499 |
| 74 | Ga0466705_126170 | 3300042612 | Bacteria | 3915 |
| 75 | Ga0466705_251788 | 3300042612 | Bacteria | 6358 |
| 76 | Ga0466732_018385 | 3300042656 | Bacteria | 5777 |
| 77 | Ga0264413_134893 | 3300024493 | Unclassified | 2935 |
| 78 | Ga0466690_049621 | 3300042590 | Bacteria | 4411 |
| 79 | Ga0466690_133096 | 3300042590 | Bacteria | 3276 |
| 80 | Ga0466690_310988 | 3300042590 | Bacteria | 16075 |
| 81 | Ga0466690_391092 | 3300042590 | Bacteria | 5068 |
| 82 | Ga0466691_026425 | 3300042593 | Bacteria | 17266 |
| 83 | Ga0466694_052932 | 3300042594 | Unclassified | 1670 |
| 84 | Ga0466696_019725 | 3300042596 | Bacteria | 19619 |
| 85 | Ga0466696_081213 | 3300042596 | Bacteria | 2829 |
| 86 | Ga0466696_490354 | 3300042596 | Unclassified | 2347 |
| 87 | Ga0466699_023741 | 3300042597 | Bacteria | 1187 |
| 88 | Ga0466716_157285 | 3300042605 | Bacteria | 5303 |
| 89 | Ga0466722_025023 | 3300042609 | Bacteria | 3239 |
| 90 | Ga0466722_258233 | 3300042609 | Archaea | 6142 |
| 91 | Ga0068305_10256910 | 3300005083 | Bacteria | 3896 |
| 92 | Ga0466703_297651 | 3300042636 | Unclassified | 2493 |
| 93 | Ga0466704_372936 | 3300042643 | Bacteria | 10686 |
| 94 | Ga0466709_013787 | 3300042648 | Bacteria | 3743 |
| 95 | Ga0466709_303048 | 3300042648 | Bacteria | 10457 |
| 96 | Ga0466708_216283 | 3300042652 | Bacteria | 4197 |
| 97 | Ga0466727_288242 | 3300042655 | Bacteria | 2880 |
| 98 | Ga0466727_296143 | 3300042655 | Bacteria | 2697 |
| 99 | Ga0466711_448538 | 3300042615 | Bacteria | 9543 |
| 100 | Ga0466715_016915 | 3300042616 | Bacteria | 3481 |
| 101 | Ga0466715_361094 | 3300042616 | Bacteria | 7675 |
| 102 | Ga0466723_112721 | 3300042618 | Unclassified | 1316 |
| 103 | Ga0466723_266186 | 3300042618 | Bacteria | 9062 |
| 104 | Ga0466726_234623 | 3300042619 | Bacteria | 1112 |
| 105 | Ga0466729_120053 | 3300042621 | Bacteria | 1595 |
| 106 | Ga0466733_176910 | 3300042659 | Bacteria | 6635 |
| 107 | Ga0466691_022254 | 3300042593 | Bacteria | 9828 |
| 108 | Ga0466719_162781 | 3300042606 | Bacteria | 7772 |
| 109 | Ga0466722_107109 | 3300042609 | Bacteria | 17265 |
| 110 | Ga0466722_215644 | 3300042609 | Bacteria | 7518 |
| 111 | Ga0072940_1055876 | 3300005200 | Bacteria | 3501 |
| 112 | Ga0466735_028503 | 3300042624 | Bacteria | 1630 |
| 113 | Ga0466703_062233 | 3300042636 | Bacteria | 6890 |
| 114 | Ga0466704_551637 | 3300042643 | Bacteria | 24753 |
| 115 | Ga0466709_095666 | 3300042648 | Bacteria | 7030 |
| 116 | Ga0466709_233146 | 3300042648 | Bacteria | 1514 |
| 117 | Ga0466708_337452 | 3300042652 | Bacteria | 2219 |
| 118 | Ga0466727_042182 | 3300042655 | Unclassified | 5441 |
| 119 | Ga0466712_319783 | 3300042614 | Bacteria | 5795 |
| 120 | Ga0466711_027367 | 3300042615 | Bacteria | 4305 |
| 121 | Ga0466718_130563 | 3300042617 | Bacteria | 5691 |
| 122 | Ga0466726_140485 | 3300042619 | Bacteria | 13232 |
| 123 | Ga0466726_496736 | 3300042619 | Bacteria | 1046 |
| 124 | Ga0466728_072910 | 3300042620 | Unclassified | 4875 |
| 125 | Ga0466729_079542 | 3300042621 | Bacteria | 1729 |
| 126 | Ga0466729_173835 | 3300042621 | Bacteria | 1064 |
| 127 | Ga0466690_010209 | 3300042590 | Bacteria | 2569 |
| 128 | Ga0466692_204869 | 3300042591 | Bacteria | 12273 |
| 129 | Ga0466691_041202 | 3300042593 | Bacteria | 11411 |
| 130 | Ga0466691_096767 | 3300042593 | Bacteria | 15014 |
| 131 | Ga0466691_100530 | 3300042593 | Bacteria | 14275 |
| 132 | Ga0466691_156293 | 3300042593 | Bacteria | 9354 |
| 133 | Ga0466691_166171 | 3300042593 | Bacteria | 5786 |
| 134 | Ga0466691_213594 | 3300042593 | Bacteria | 11407 |
| 135 | Ga0466707_157919 | 3300042601 | Bacteria | 2302 |
| 136 | Ga0466716_259141 | 3300042605 | Bacteria | 8550 |
| 137 | Ga0466719_027391 | 3300042606 | Bacteria | 7600 |
| 138 | Ga0466703_059612 | 3300042636 | Bacteria | 4883 |
| 139 | Ga0466703_272627 | 3300042636 | Bacteria | 11884 |
| 140 | Ga0466704_228063 | 3300042643 | Bacteria | 2168 |
| 141 | Ga0466709_151345 | 3300042648 | Bacteria | 6960 |
| 142 | Ga0466727_056472 | 3300042655 | Bacteria | 2592 |
| 143 | Ga0466727_196089 | 3300042655 | Bacteria | 20518 |
| 144 | Ga0466727_287962 | 3300042655 | Bacteria | 2251 |
| 145 | Ga0466727_337497 | 3300042655 | Bacteria | 4604 |
| 146 | Ga0466715_490857 | 3300042616 | Bacteria | 5859 |
| 147 | Ga0466718_052009 | 3300042617 | Bacteria | 7177 |
| 148 | Ga0466723_036772 | 3300042618 | Bacteria | 5113 |
| 149 | Ga0466723_073793 | 3300042618 | Bacteria | 6798 |
| 150 | Ga0466726_252784 | 3300042619 | Bacteria | 3748 |
| 151 | Ga0466726_276453 | 3300042619 | Bacteria | 8095 |
| 152 | Ga0466726_394867 | 3300042619 | Bacteria | 3945 |
| 153 | Ga0466728_069100 | 3300042620 | Bacteria | 16985 |
| 154 | Ga0466728_358035 | 3300042620 | Bacteria | 9828 |
| 155 | Ga0466728_465293 | 3300042620 | Bacteria | 1835 |
| 156 | Ga0466692_195981 | 3300042591 | Bacteria | 1245 |
| 157 | Ga0466691_089154 | 3300042593 | Bacteria | 17542 |
| 158 | Ga0466716_050203 | 3300042605 | Bacteria | 2948 |
| 159 | Ga0466716_081856 | 3300042605 | Bacteria | 13738 |
| 160 | Ga0466719_266729 | 3300042606 | Bacteria | 26645 |
| 161 | Ga0466722_146292 | 3300042609 | Bacteria | 4867 |
| 162 | JGI24698J34947_10016617 | 3300002449 | Bacteria | 3992 |
| 163 | JGI24700J35501_10929126 | 3300002508 | Bacteria | 8640 |
| 164 | Ga0466703_416104 | 3300042636 | Bacteria | 1862 |
| 165 | Ga0466704_061351 | 3300042643 | Bacteria | 5899 |
| 166 | Ga0466709_085877 | 3300042648 | Bacteria | 13131 |
| 167 | Ga0466708_049317 | 3300042652 | Bacteria | 23244 |
| 168 | Ga0466708_349169 | 3300042652 | Bacteria | 19112 |
| 169 | Ga0466727_151685 | 3300042655 | Bacteria | 2530 |
| 170 | Ga0466711_003262 | 3300042615 | Bacteria | 15008 |
| 171 | Ga0466715_017605 | 3300042616 | Bacteria | 24965 |
| 172 | Ga0466723_129009 | 3300042618 | Bacteria | 12957 |
| 173 | Ga0466705_045281 | 3300042612 | Unclassified | 1272 |
| 174 | Ga0466705_272442 | 3300042612 | Bacteria | 9671 |
| 175 | Ga0466732_001115 | 3300042656 | Bacteria | 2470 |
| 176 | Ga0466732_172987 | 3300042656 | Bacteria | 7859 |
| 177 | Ga0123353_10409152 | 3300010167 | Bacteria | 2015 |
| 178 | Ga0264413_118706 | 3300024493 | Bacteria | 3843 |
| 179 | Ga0466690_035744 | 3300042590 | Bacteria | 9785 |
| 180 | Ga0466690_378185 | 3300042590 | Bacteria | 5503 |
| 181 | Ga0466692_102451 | 3300042591 | Bacteria | 3462 |
| 182 | Ga0466707_107862 | 3300042601 | Bacteria | 10010 |
| 183 | Ga0466716_121016 | 3300042605 | Bacteria | 7508 |
| 184 | Ga0466719_535354 | 3300042606 | Bacteria | 6940 |
| 185 | Ga0466722_246829 | 3300042609 | Bacteria | 3335 |
| 186 | JGI24698J34947_10000534 | 3300002449 | Bacteria | 17958 |
| 187 | JGI24696J40584_12952379 | 3300002834 | Bacteria | 2340 |
| 188 | Ga0466735_040660 | 3300042624 | Bacteria | 16748 |
| 189 | Ga0466703_114635 | 3300042636 | Bacteria | 3205 |
| 190 | Ga0466704_152692 | 3300042643 | Bacteria | 1559 |
| 191 | Ga0466727_137747 | 3300042655 | Bacteria | 1796 |
| 192 | Ga0466715_137940 | 3300042616 | Bacteria | 14190 |
| 193 | Ga0466723_124965 | 3300042618 | Unclassified | 2924 |
| 194 | Ga0466723_340289 | 3300042618 | Bacteria | 4168 |
| 195 | Ga0466726_012948 | 3300042619 | Bacteria | 23489 |
| 196 | Ga0466726_394064 | 3300042619 | Bacteria | 1592 |
| 197 | Ga0466726_439507 | 3300042619 | Bacteria | 12392 |
| 198 | Ga0466728_085517 | 3300042620 | Bacteria | 27565 |
| 199 | Ga0466728_221118 | 3300042620 | Bacteria | 4175 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03480 | DctP | Bacterial extracellular solute-binding protein, family 7 | 94 | 344 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03480 | GO:0055085 | transmembrane transport | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.