Protein Family IF00905
Metagenome
Isolate
208
Members
45
Samples
197
Scaffolds
134.27
Avg Length
Representative Sequence
- ID
- 3300002507|JGI24697J35500_11268470|JGI24697J35500_112684702
- Length
- 156 aa
- Sequence
- MRFYKEVVQKLKFLNNSGYMGKASFKKYVYIYTDGGPEKWAFVVVKDGKVIHEESGIFGLSASTSNDDTESEGIFRAIQYAKERPDNYILTTDSQAIIAKVNGNVANVTRNPNICGIQTLLREFKDSPLPVSFSIKWEKRLSNEFMKRADELCGE*
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.8%
Unclassified
23.3%
Kalotermitidae
11.6%
Rhinotermitidae
2.3%
Taxonomy
Archaea
2
Bacteria
148
Eukaryota
1
Viruses
0
Unclassified
57
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 4 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 17 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 18 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 28 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 29 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 30 | 2228664018 | Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 | Metagenome | Termitidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 33 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 34 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 35 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 43 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466694_135377 | 3300042594 | Bacteria | 1807 |
| 2 | Ga0466699_354908 | 3300042597 | Bacteria | 1815 |
| 3 | Ga0123356_10002023 | 3300010049 | Archaea | 21906 |
| 4 | Ga0123356_10018046 | 3300010049 | Bacteria | 6703 |
| 5 | Ga0123356_10217996 | 3300010049 | Bacteria | 1962 |
| 6 | Ga0466712_059194 | 3300042614 | Bacteria | 5759 |
| 7 | Ga0466712_074325 | 3300042614 | Bacteria | 4455 |
| 8 | Ga0466712_145818 | 3300042614 | Bacteria | 1333 |
| 9 | JGI24698J34947_10003325 | 3300002449 | Bacteria | 8724 |
| 10 | JGI24698J34947_10012052 | 3300002449 | Bacteria | 4746 |
| 11 | JGI24698J34947_10046535 | 3300002449 | Unclassified | 2206 |
| 12 | JGI24698J34947_10058378 | 3300002449 | Bacteria | 1911 |
| 13 | JGI24698J34947_10061099 | 3300002449 | Bacteria | 1856 |
| 14 | JGI24698J34947_10102562 | 3300002449 | Unclassified | 1282 |
| 15 | JGI24698J34947_10158183 | 3300002449 | Unclassified | 932 |
| 16 | JGI24695J34938_10011455 | 3300002450 | Bacteria | 4776 |
| 17 | JGI24695J34938_10017919 | 3300002450 | Bacteria | 3556 |
| 18 | JGI24702J35022_10535403 | 3300002462 | Bacteria | 721 |
| 19 | Ga0072941_1086740 | 3300005201 | Unclassified | 1590 |
| 20 | Ga0072941_1294851 | 3300005201 | Unclassified | 638 |
| 21 | Ga0466702_155573 | 3300042635 | Bacteria | 1315 |
| 22 | Ga0466702_179446 | 3300042635 | Bacteria | 3452 |
| 23 | Ga0466702_270461 | 3300042635 | Bacteria | 2530 |
| 24 | Ga0466703_181012 | 3300042636 | Bacteria | 22339 |
| 25 | Ga0466732_231469 | 3300042656 | Unclassified | 1196 |
| 26 | Ga0264413_108964 | 3300024493 | Bacteria | 1785 |
| 27 | Ga0415639_149063 | 3300038395 | Unclassified | 1290 |
| 28 | Ga0466694_010117 | 3300042594 | Bacteria | 3199 |
| 29 | Ga0466694_339053 | 3300042594 | Bacteria | 4102 |
| 30 | Ga0466699_078632 | 3300042597 | Bacteria | 6979 |
| 31 | Ga0466699_329853 | 3300042597 | Bacteria | 1847 |
| 32 | Ga0123356_13218319 | 3300010049 | Bacteria | 568 |
| 33 | Ga0466712_062408 | 3300042614 | Bacteria | 9799 |
| 34 | Ga0466712_227010 | 3300042614 | Unclassified | 1154 |
| 35 | Ga0466718_018097 | 3300042617 | Bacteria | 2111 |
| 36 | Ga0466718_148118 | 3300042617 | Unclassified | 1452 |
| 37 | JGI24698J34947_10000359 | 3300002449 | Unclassified | 20386 |
| 38 | JGI24698J34947_10014956 | 3300002449 | Unclassified | 4225 |
| 39 | JGI24698J34947_10050141 | 3300002449 | Unclassified | 2106 |
| 40 | JGI24698J34947_10125668 | 3300002449 | Unclassified | 1105 |
| 41 | JGI24698J34947_10213214 | 3300002449 | Unclassified | 746 |
| 42 | JGI24695J34938_10007744 | 3300002450 | Bacteria | 6227 |
| 43 | JGI24695J34938_10040986 | 3300002450 | Unclassified | 2081 |
| 44 | JGI24702J35022_10302675 | 3300002462 | Unclassified | 944 |
| 45 | Ga0072940_1398048 | 3300005200 | Bacteria | 893 |
| 46 | Ga0072941_1045269 | 3300005201 | Bacteria | 3700 |
| 47 | Ga0072941_1046216 | 3300005201 | Bacteria | 2303 |
| 48 | Ga0072941_1103649 | 3300005201 | Bacteria | 1666 |
| 49 | Ga0466702_124742 | 3300042635 | Bacteria | 24190 |
| 50 | Ga0466702_396990 | 3300042635 | Bacteria | 3555 |
| 51 | Ga0466690_179867 | 3300042590 | Bacteria | 9633 |
| 52 | Ga0466694_074997 | 3300042594 | Bacteria | 4715 |
| 53 | Ga0466699_049873 | 3300042597 | Bacteria | 1542 |
| 54 | Ga0466699_057243 | 3300042597 | Bacteria | 1148 |
| 55 | Ga0466699_081603 | 3300042597 | Unclassified | 1050 |
| 56 | Ga0123356_10135304 | 3300010049 | Bacteria | 2421 |
| 57 | Ga0123356_10199704 | 3300010049 | Bacteria | 2038 |
| 58 | Ga0123353_10026422 | 3300010167 | Bacteria | 8868 |
| 59 | Ga0466712_003740 | 3300042614 | Bacteria | 5260 |
| 60 | Ga0466715_203643 | 3300042616 | Unclassified | 1228 |
| 61 | AmiMGMT1_c403003 | 2228664018 | Unclassified | 645 |
| 62 | AustNasuHG_c1019425 | 3300000089 | Bacteria | 2229 |
| 63 | JGI24698J34947_10121310 | 3300002449 | Eukaryota | 1134 |
| 64 | JGI24695J34938_10000217 | 3300002450 | Bacteria | 55213 |
| 65 | JGI24695J34938_10001184 | 3300002450 | Bacteria | 23181 |
| 66 | JGI24695J34938_10002888 | 3300002450 | Bacteria | 12508 |
| 67 | JGI24695J34938_10011737 | 3300002450 | Bacteria | 4700 |
| 68 | JGI24695J34938_10036527 | 3300002450 | Unclassified | 2239 |
| 69 | JGI24695J34938_10051685 | 3300002450 | Unclassified | 1796 |
| 70 | JGI24695J34938_10276535 | 3300002450 | Unclassified | 719 |
| 71 | JGI24697J35500_11268470 | 3300002507 | Bacteria | 3811 |
| 72 | Ga0072941_1002570 | 3300005201 | Bacteria | 31727 |
| 73 | Ga0466731_121617 | 3300042622 | Bacteria | 1400 |
| 74 | Ga0466709_242607 | 3300042648 | Bacteria | 1304 |
| 75 | Ga0466732_143736 | 3300042656 | Bacteria | 4548 |
| 76 | Ga0466732_332167 | 3300042656 | Bacteria | 1356 |
| 77 | Ga0466700_262131 | 3300042600 | Unclassified | 1325 |
| 78 | Ga0264413_102775 | 3300024493 | Bacteria | 7660 |
| 79 | Ga0466694_138164 | 3300042594 | Bacteria | 7862 |
| 80 | Ga0466694_264138 | 3300042594 | Bacteria | 6755 |
| 81 | Ga0466694_351399 | 3300042594 | Bacteria | 1757 |
| 82 | Ga0466699_230776 | 3300042597 | Bacteria | 11603 |
| 83 | Ga0466699_348044 | 3300042597 | Bacteria | 1614 |
| 84 | Ga0123356_10740664 | 3300010049 | Bacteria | 1153 |
| 85 | Ga0466712_023972 | 3300042614 | Bacteria | 40905 |
| 86 | Ga0466718_037299 | 3300042617 | Bacteria | 21210 |
| 87 | Ga0466718_067367 | 3300042617 | Bacteria | 1046 |
| 88 | JGI24698J34947_10008515 | 3300002449 | Bacteria | 5631 |
| 89 | JGI24698J34947_10046436 | 3300002449 | Unclassified | 2209 |
| 90 | JGI24695J34938_10000168 | 3300002450 | Bacteria | 61343 |
| 91 | JGI24695J34938_10013149 | 3300002450 | Bacteria | 4358 |
| 92 | JGI24702J35022_10074718 | 3300002462 | Unclassified | 1830 |
| 93 | Ga0072941_1012621 | 3300005201 | Bacteria | 35504 |
| 94 | Ga0072941_1044609 | 3300005201 | Bacteria | 2735 |
| 95 | Ga0072941_1134511 | 3300005201 | Unclassified | 938 |
| 96 | Ga0466702_010869 | 3300042635 | Bacteria | 1465 |
| 97 | Ga0466699_139762 | 3300042597 | Bacteria | 1523 |
| 98 | Ga0123356_13091714 | 3300010049 | Unclassified | 580 |
| 99 | Ga0123356_13694328 | 3300010049 | Bacteria | 529 |
| 100 | Ga0466712_088106 | 3300042614 | Bacteria | 5131 |
| 101 | Ga0466712_094048 | 3300042614 | Unclassified | 1753 |
| 102 | Ga0466712_109051 | 3300042614 | Unclassified | 3040 |
| 103 | Ga0466718_009571 | 3300042617 | Bacteria | 2400 |
| 104 | Ga0466718_021875 | 3300042617 | Unclassified | 1831 |
| 105 | JGI24698J34947_10003831 | 3300002449 | Bacteria | 8189 |
| 106 | JGI24698J34947_10006845 | 3300002449 | Unclassified | 6266 |
| 107 | JGI24698J34947_10019689 | 3300002449 | Unclassified | 3636 |
| 108 | JGI24695J34938_10003380 | 3300002450 | Bacteria | 11208 |
| 109 | Ga0072940_1053005 | 3300005200 | Unclassified | 815 |
| 110 | Ga0072941_1039885 | 3300005201 | Bacteria | 9460 |
| 111 | Ga0466731_138728 | 3300042622 | Bacteria | 1345 |
| 112 | Ga0466717_251314 | 3300042604 | Bacteria | 3543 |
| 113 | Ga0466720_188906 | 3300042607 | Bacteria | 1197 |
| 114 | Ga0466720_234656 | 3300042607 | Bacteria | 2240 |
| 115 | Ga0466693_028718 | 3300042592 | Bacteria | 33667 |
| 116 | Ga0466694_054313 | 3300042594 | Bacteria | 2304 |
| 117 | Ga0466699_139070 | 3300042597 | Bacteria | 3836 |
| 118 | Ga0466699_149430 | 3300042597 | Unclassified | 4664 |
| 119 | Ga0466699_274409 | 3300042597 | Bacteria | 1318 |
| 120 | Ga0123356_10319879 | 3300010049 | Unclassified | 1664 |
| 121 | Ga0123356_10538868 | 3300010049 | Bacteria | 1327 |
| 122 | Ga0123356_11288805 | 3300010049 | Bacteria | 894 |
| 123 | Ga0123353_10490280 | 3300010167 | Bacteria | 1794 |
| 124 | Ga0466712_019884 | 3300042614 | Bacteria | 29756 |
| 125 | Ga0466712_142140 | 3300042614 | Bacteria | 2826 |
| 126 | Ga0466712_210986 | 3300042614 | Unclassified | 1300 |
| 127 | Ga0466718_080453 | 3300042617 | Bacteria | 3673 |
| 128 | AustNasuHG_c1011242 | 3300000089 | Bacteria | 3104 |
| 129 | JGI24698J34947_10002346 | 3300002449 | Bacteria | 10184 |
| 130 | JGI24698J34947_10003778 | 3300002449 | Bacteria | 8253 |
| 131 | JGI24698J34947_10011263 | 3300002449 | Unclassified | 4910 |
| 132 | JGI24698J34947_10037657 | 3300002449 | Unclassified | 2512 |
| 133 | JGI24698J34947_10160405 | 3300002449 | Bacteria | 922 |
| 134 | JGI24695J34938_10001879 | 3300002450 | Bacteria | 17053 |
| 135 | JGI24695J34938_10018478 | 3300002450 | Unclassified | 3481 |
| 136 | JGI24695J34938_10035119 | 3300002450 | Bacteria | 2295 |
| 137 | Ga0466729_312235 | 3300042621 | Bacteria | 3341 |
| 138 | Ga0466729_314786 | 3300042621 | Bacteria | 2231 |
| 139 | Ga0466702_015706 | 3300042635 | Unclassified | 1245 |
| 140 | Ga0466721_404408 | 3300042608 | Unclassified | 1228 |
| 141 | Ga0466698_217381 | 3300042610 | Unclassified | 2293 |
| 142 | Ga0415639_043199 | 3300038395 | Bacteria | 4237 |
| 143 | Ga0466694_184435 | 3300042594 | Bacteria | 6581 |
| 144 | Ga0466694_407837 | 3300042594 | Unclassified | 1578 |
| 145 | Ga0466699_070774 | 3300042597 | Bacteria | 1690 |
| 146 | Ga0123357_10179840 | 3300009784 | Bacteria | 2473 |
| 147 | Ga0123356_10042992 | 3300010049 | Bacteria | 4207 |
| 148 | Ga0123356_10479588 | 3300010049 | Bacteria | 1396 |
| 149 | Ga0123356_11401950 | 3300010049 | Unclassified | 859 |
| 150 | Ga0123356_12956448 | 3300010049 | Unclassified | 594 |
| 151 | Ga0466712_059926 | 3300042614 | Bacteria | 21750 |
| 152 | Ga0466712_066146 | 3300042614 | Bacteria | 2749 |
| 153 | Ga0466712_186290 | 3300042614 | Unclassified | 2556 |
| 154 | Ga0466712_234214 | 3300042614 | Bacteria | 4404 |
| 155 | Ga0466718_131284 | 3300042617 | Bacteria | 9268 |
| 156 | JGI24698J34947_10001100 | 3300002449 | Bacteria | 13934 |
| 157 | JGI24698J34947_10014904 | 3300002449 | Bacteria | 4233 |
| 158 | JGI24698J34947_10024168 | 3300002449 | Bacteria | 3246 |
| 159 | JGI24698J34947_10028420 | 3300002449 | Bacteria | 2960 |
| 160 | JGI24698J34947_10081027 | 3300002449 | Unclassified | 1523 |
| 161 | JGI24698J34947_10139579 | 3300002449 | Bacteria | 1023 |
| 162 | JGI24695J34938_10006442 | 3300002450 | Bacteria | 7046 |
| 163 | JGI24695J34938_10008966 | 3300002450 | Unclassified | 5629 |
| 164 | JGI24695J34938_10022199 | 3300002450 | Bacteria | 3088 |
| 165 | JGI24695J34938_10191437 | 3300002450 | Bacteria | 850 |
| 166 | JGI24699J35502_10995762 | 3300002509 | Unclassified | 1330 |
| 167 | Ga0072941_1039348 | 3300005201 | Bacteria | 5907 |
| 168 | Ga0072941_1052103 | 3300005201 | Bacteria | 2369 |
| 169 | Ga0072941_1247122 | 3300005201 | Bacteria | 1389 |
| 170 | Ga0466702_209633 | 3300042635 | Bacteria | 18010 |
| 171 | Ga0466702_451768 | 3300042635 | Unclassified | 2440 |
| 172 | Ga0466700_063945 | 3300042600 | Bacteria | 1086 |
| 173 | Ga0466720_035107 | 3300042607 | Bacteria | 4148 |
| 174 | Ga0415639_107952 | 3300038395 | Unclassified | 1862 |
| 175 | Ga0466690_273999 | 3300042590 | Unclassified | 1571 |
| 176 | Ga0466694_006403 | 3300042594 | Bacteria | 53277 |
| 177 | Ga0466695_295531 | 3300042595 | Bacteria | 145433 |
| 178 | Ga0466699_008178 | 3300042597 | Unclassified | 1359 |
| 179 | Ga0466699_047701 | 3300042597 | Bacteria | 8769 |
| 180 | Ga0466699_359058 | 3300042597 | Bacteria | 9135 |
| 181 | Ga0123356_11317182 | 3300010049 | Bacteria | 885 |
| 182 | Ga0123356_12528554 | 3300010049 | Unclassified | 643 |
| 183 | Ga0466712_004711 | 3300042614 | Archaea | 2670 |
| 184 | Ga0466712_220733 | 3300042614 | Bacteria | 11323 |
| 185 | Ga0466712_247660 | 3300042614 | Bacteria | 8293 |
| 186 | Ga0466723_211822 | 3300042618 | Bacteria | 10099 |
| 187 | Nasutiter_Contig08998 | 2030936001 | Bacteria | 1538 |
| 188 | JGI24698J34947_10000227 | 3300002449 | Bacteria | 23213 |
| 189 | JGI24698J34947_10021850 | 3300002449 | Bacteria | 3438 |
| 190 | JGI24698J34947_10034400 | 3300002449 | Unclassified | 2651 |
| 191 | JGI24698J34947_10038237 | 3300002449 | Bacteria | 2489 |
| 192 | JGI24698J34947_10067218 | 3300002449 | Unclassified | 1740 |
| 193 | JGI24695J34938_10086909 | 3300002450 | Bacteria | 1286 |
| 194 | JGI24702J35022_10059412 | 3300002462 | Bacteria | 2043 |
| 195 | Ga0072940_1020021 | 3300005200 | Unclassified | 1640 |
| 196 | Ga0072941_1066761 | 3300005201 | Bacteria | 7853 |
| 197 | Ga0466702_137399 | 3300042635 | Bacteria | 3068 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00075 | RNase_H | RNase H | 27 | 112 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.