Protein Family IF00899

Metagenome Isolate
204 Members
73 Samples
153 Scaffolds
473.74 Avg Length

🧬 Representative Sequence

ID
3300002504|JGI24705J35276_12237869|JGI24705J35276_1223786910
Length
523 aa
Sequence
MPDFAFLFDFAFLGKKAGKKRQKSISLQMTKIFAIMRKTYKKENITMFNTLSDAKYYIKENEIKMIDLMMTDLNGRFRHVTLPCERLTAEVFEYGIGFDGSNYGFAPVESSDMVFIPDLKTAYLDPFAEVATLAMLGGVYVIDLPQNRRFDQDPRNVALQAEDYLSKSGIADNIRISPEFEFHVFDHVSYSLLPHASGFCVDSEKAEWNSSLKGFNMGYKMAKKGGYHMAPPLDDLHGFRSRASLLMEKSGIKVKYHHHEVGGPGQSEIEVEFGGLLEMADKTMMTKYILKNAAIAENKTVTFLPKPIYGEAGNGLHVHMHLFKNGLPLFYDPHGYAQFSETAMHFMGGILRHASALCAFTNPSTNSYKRLTPGYEAPVTVGFATSNRSAVIRIPAYAKSPAEKRFELRSPDGTCNPYYAYAAILMAGIDGVQKKIDPVEESYGPYDFNLFNLPEEEKAKIMSLPQSLEKALDELEKDHDFLTAAAVFPQNLIEIWLKNRKAEVDYYNQLPHPLEYALYFDL*

πŸ“Š Sample Types

Isolate 25.0%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 70.8%
Termitidae 27.8%
Passalidae 1.4%

🌳 Taxonomy

Archaea 10
Bacteria 177
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
2 2772190991 Unclassified Bathyarchaeota Emb289P3bin109 Isolate Unclassified
3 2772190996 Unclassified Bathyarchaeota Lab288P4bin61 Isolate Unclassified
4 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
5 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
6 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
7 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
11 2772190994 Unclassified Bathyarchaeota Lab288P3bin169 Isolate Unclassified
12 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
13 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
14 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
22 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
23 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
24 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
25 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
26 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
27 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
28 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
29 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
30 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
31 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
32 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
33 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
34 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
35 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 2820852808 Unclassified Actinobacteria Lab288P3bin25 Isolate Unclassified
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
42 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
43 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
44 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
45 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
48 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
49 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
50 2772190990 Unclassified Bathyarchaeota Emb289P1bin127 Isolate Unclassified
51 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
52 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
53 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
54 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
55 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
56 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
57 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
58 2820874551 Unclassified Actinobacteria Lab288P1bin85 Isolate Unclassified
59 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
60 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
61 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
62 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
63 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
64 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
65 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
66 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
67 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
68 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
69 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
70 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
71 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466717_068562 3300042604 Bacteria 1529
2 Ga0123356_10000069 3300010049 Bacteria 108106
3 Ga0123356_10002753 3300010049 Bacteria 18673
4 Ga0123356_10007045 3300010049 Bacteria 11271
5 Ga0123356_10009029 3300010049 Bacteria 9864
6 Ga0123356_10086908 3300010049 Bacteria 2969
7 Ga0123356_10136308 3300010049 Unclassified 2413
8 Ga0123353_10036350 3300010167 Bacteria 7713
9 Ga0123353_10065260 3300010167 Bacteria 5844
10 Ga0123353_10213692 3300010167 Bacteria 3023
11 Ga0123353_10220014 3300010167 Bacteria 2970
12 Ga0123354_10005771 3300010882 Bacteria 18135
13 JGI24702J35022_10000147 3300002462 Bacteria 35962
14 Ga0072941_1058913 3300005201 Bacteria 13272
15 Ga0466702_335427 3300042635 Bacteria 3112
16 Ga0415639_154562 3300038395 Bacteria 3179
17 Ga0466694_307132 3300042594 Bacteria 16269
18 Ga0466700_037189 3300042600 Bacteria 2600
19 Ga0466717_005351 3300042604 Bacteria 2461
20 Ga0466721_045257 3300042608 Bacteria 26745
21 Ga0123355_10000430 3300009826 Bacteria 55069
22 Ga0123355_10001629 3300009826 Bacteria 31308
23 Ga0123355_10116766 3300009826 Bacteria 4151
24 Ga0123356_10004744 3300010049 Bacteria 14006
25 Ga0123356_10007174 3300010049 Bacteria 11155
26 Ga0123356_10014095 3300010049 Bacteria 7688
27 Ga0123353_10029284 3300010167 Bacteria 8482
28 Ga0123353_10036758 3300010167 Bacteria 7673
29 Ga0123353_10253628 3300010167 Bacteria 2722
30 Ga0123353_10348490 3300010167 Archaea 2233
31 Ga0123353_10396130 3300010167 Bacteria 2057
32 JGI24702J35022_10000438 3300002462 Bacteria 25142
33 JGI24702J35022_10003626 3300002462 Bacteria 9304
34 JGI24702J35022_10015965 3300002462 Bacteria 4124
35 Ga0466697_269583 3300042611 Unclassified 10229
36 Ga0466700_031304 3300042600 Bacteria 1978
37 Ga0466714_020081 3300042603 Bacteria 30959
38 Ga0123357_10025286 3300009784 Bacteria 8007
39 Ga0123357_10059715 3300009784 Bacteria 5116
40 Ga0123355_10030021 3300009826 Bacteria 8809
41 Ga0123356_10000343 3300010049 Bacteria 53709
42 Ga0123356_10010157 3300010049 Bacteria 9258
43 Ga0123356_10043897 3300010049 Unclassified 4162
44 Ga0123356_10060144 3300010049 Bacteria 3545
45 Ga0123353_10000647 3300010167 Bacteria 42611
46 Ga0123353_10173133 3300010167 Bacteria 3425
47 Ga0123353_10183844 3300010167 Bacteria 3307
48 Ga0123353_10200477 3300010167 Bacteria 3140
49 2227175241 2225789004 Bacteria 8158
50 2227191914 2225789004 Bacteria 33932
51 JGI24702J35022_10000605 3300002462 Bacteria 21778
52 Ga0123357_10000228 3300009784 Bacteria 53070
53 Ga0466734_136601 3300042623 Bacteria 3697
54 Ga0415639_000305 3300038395 Bacteria 4001
55 Ga0415639_082790 3300038395 Bacteria 3650
56 Ga0415639_154389 3300038395 Archaea 2419
57 Ga0466733_067574 3300042659 Bacteria 9906
58 Ga0466700_017834 3300042600 Bacteria 40737
59 Ga0123357_10188325 3300009784 Bacteria 2386
60 Ga0123356_10005408 3300010049 Bacteria 13002
61 Ga0123356_10007229 3300010049 Bacteria 11103
62 Ga0123356_10020302 3300010049 Unclassified 6288
63 Ga0123356_10037238 3300010049 Bacteria 4540
64 Ga0123356_10205811 3300010049 Bacteria 2012
65 Ga0123353_10199177 3300010167 Bacteria 3152
66 Ga0123353_10322477 3300010167 Archaea 2343
67 Ga0123353_10327679 3300010167 Bacteria 2320
68 Ga0123353_10470734 3300010167 Bacteria 1842
69 Ga0123354_10108638 3300010882 Bacteria 3683
70 JGI24705J35276_12206743 3300002504 Bacteria 1728
71 JGI24705J35276_12237869 3300002504 Bacteria 13697
72 Ga0415639_001275 3300038395 Bacteria 24185
73 Ga0415639_002050 3300038395 Bacteria 34452
74 Ga0466694_222897 3300042594 Bacteria 2350
75 Ga0466714_073908 3300042603 Bacteria 2603
76 Ga0123357_10081228 3300009784 Bacteria 4261
77 Ga0123357_10202813 3300009784 Unclassified 2251
78 Ga0123356_10000455 3300010049 Bacteria 45828
79 Ga0123356_10008415 3300010049 Bacteria 10258
80 Ga0123356_10303476 3300010049 Bacteria 1703
81 Ga0123353_10044531 3300010167 Bacteria 7035
82 Ga0123353_10053685 3300010167 Bacteria 6441
83 Ga0123353_10160958 3300010167 Bacteria 3574
84 Ga0123353_10239700 3300010167 Unclassified 2819
85 Ga0123353_10249534 3300010167 Bacteria 2750
86 Ga0123353_10332198 3300010167 Bacteria 2300
87 Ga0123354_10000330 3300010882 Unclassified 43958
88 Ga0466731_047260 3300042622 Bacteria 6342
89 Ga0415639_002793 3300038395 Bacteria 128323
90 Ga0415639_021596 3300038395 Unclassified 3805
91 Ga0415639_084921 3300038395 Bacteria 3181
92 Ga0466695_335011 3300042595 Unclassified 2219
93 Ga0466717_038314 3300042604 Archaea 1805
94 Ga0466717_312410 3300042604 Unclassified 2308
95 Ga0466721_185567 3300042608 Bacteria 10654
96 Ga0466721_383437 3300042608 Unclassified 2840
97 Ga0123356_10000734 3300010049 Bacteria 36122
98 Ga0123356_10001199 3300010049 Bacteria 28734
99 Ga0123356_10002769 3300010049 Bacteria 18626
100 Ga0123356_10006950 3300010049 Bacteria 11363
101 Ga0123356_10009617 3300010049 Bacteria 9539
102 Ga0123356_10115743 3300010049 Bacteria 2598
103 Ga0123356_10195167 3300010049 Bacteria 2059
104 Ga0123356_10349000 3300010049 Bacteria 1603
105 Ga0123353_10000236 3300010167 Bacteria 69878
106 Ga0123353_10083695 3300010167 Bacteria 5134
107 Ga0123353_10084691 3300010167 Bacteria 5103
108 Ga0123353_10321871 3300010167 Bacteria 2346
109 Ga0123353_10337529 3300010167 Bacteria 2278
110 Ga0123353_10592796 3300010167 Bacteria 1587
111 Ga0466710_411117 3300042613 Bacteria 15434
112 JGI24702J35022_10000751 3300002462 Bacteria 20006
113 JGI24702J35022_10059318 3300002462 Bacteria 2044
114 Ga0123357_10000048 3300009784 Bacteria 99672
115 Ga0466731_118484 3300042622 Bacteria 1623
116 Ga0466694_074155 3300042594 Bacteria 9975
117 Ga0466714_010127 3300042603 Bacteria 3371
118 Ga0123355_10000381 3300009826 Bacteria 57208
119 Ga0123355_10057718 3300009826 Bacteria 6281
120 Ga0123355_10198863 3300009826 Unclassified 2933
121 Ga0123356_10000733 3300010049 Bacteria 36136
122 Ga0123356_10001376 3300010049 Unclassified 26943
123 Ga0123356_10008225 3300010049 Bacteria 10381
124 Ga0123356_10016750 3300010049 Unclassified 6987
125 Ga0123356_10048335 3300010049 Bacteria 3959
126 Ga0123356_10149668 3300010049 Bacteria 2315
127 Ga0123356_10239448 3300010049 Bacteria 1885
128 Ga0123353_10074138 3300010167 Unclassified 5471
129 Ga0123353_10082832 3300010167 Unclassified 5160
130 Ga0123353_10143376 3300010167 Archaea 3824
131 Ga0123354_10257577 3300010882 Bacteria 1751
132 JGI24702J35022_10001372 3300002462 Bacteria 15114
133 JGI24702J35022_10003698 3300002462 Bacteria 9202
134 JGI24702J35022_10021183 3300002462 Archaea 3527
135 JGI24702J35022_10043744 3300002462 Bacteria 2386
136 Ga0466734_120110 3300042623 Bacteria 15574
137 Ga0466714_101285 3300042603 Bacteria 2749
138 Ga0466717_002965 3300042604 Bacteria 2322
139 Ga0123357_10050624 3300009784 Bacteria 5621
140 Ga0123355_10013217 3300009826 Bacteria 12835
141 Ga0123356_10002672 3300010049 Bacteria 18934
142 Ga0123356_10112755 3300010049 Bacteria 2629
143 Ga0123353_10000604 3300010167 Bacteria 43958
144 Ga0123353_10057234 3300010167 Bacteria 6244
145 Ga0123353_10189712 3300010167 Bacteria 3246
146 Ga0123354_10180954 3300010882 Bacteria 2407
147 JGI24702J35022_10008773 3300002462 Bacteria 5709
148 JGI24702J35022_10021326 3300002462 Bacteria 3515
149 JGI24702J35022_10038634 3300002462 Bacteria 2548
150 JGI24705J35276_12236326 3300002504 Bacteria 7842
151 Ga0466731_297322 3300042622 Bacteria 7932
152 Ga0415639_021598 3300038395 Unclassified 3389
153 Ga0466695_295531 3300042595 Bacteria 145433

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 63 140 0.97
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 152 519 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.