Protein Family IF00877
Metagenome
Isolate
116
Members
34
Samples
115
Scaffolds
204.62
Avg Length
Representative Sequence
- ID
- 3300002504|JGI24705J35276_12217636|JGI24705J35276_122176362
- Length
- 242 aa
- Sequence
- MPLPKMSTKELLREKIKKGLKDIPREEFHSQGVKAATLLRSSPVWARYTTILLFLSLKSEIDTQPLVETTLKEGKKLFVPRIEADTRSVDRKTGDRLVFYPVVSPDGPWLKGPLGIREPCFPEGTLPPQSSGGRQVPETVDFPALILVPGLAFDREGNRLGRGRGYYDRFFAELDEEGREYTPLGLCMDFQIVDRVPVEENDKKMSGFLTGKEIIISPSYLEKMYSSAYFIKKGKEHNGKN*
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
41.2%
Termitidae
35.3%
Termopsidae
8.8%
Unclassified
5.9%
Rhinotermitidae
5.9%
Hodotermitidae
2.9%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 4 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_331486 | 3300042612 | Bacteria | 57655 |
| 2 | Ga0123357_10209475 | 3300009784 | Bacteria | 2194 |
| 3 | Ga0466735_231755 | 3300042624 | Bacteria | 1330 |
| 4 | Ga0466699_192750 | 3300042597 | Bacteria | 1505 |
| 5 | Ga0466705_489643 | 3300042612 | Bacteria | 3881 |
| 6 | Ga0466715_019465 | 3300042616 | Bacteria | 3763 |
| 7 | Ga0466728_300899 | 3300042620 | Bacteria | 1786 |
| 8 | Ga0466728_460697 | 3300042620 | Bacteria | 3879 |
| 9 | Ga0466735_006740 | 3300042624 | Bacteria | 3595 |
| 10 | Ga0466704_519440 | 3300042643 | Bacteria | 3630 |
| 11 | Ga0466709_223150 | 3300042648 | Bacteria | 1739 |
| 12 | Ga0466708_009442 | 3300042652 | Bacteria | 4606 |
| 13 | Ga0466727_086152 | 3300042655 | Bacteria | 5052 |
| 14 | Ga0466727_095058 | 3300042655 | Bacteria | 1424 |
| 15 | Ga0466701_063254 | 3300042598 | Bacteria | 1125 |
| 16 | Ga0466707_256932 | 3300042601 | Bacteria | 1954 |
| 17 | Ga0466716_419635 | 3300042605 | Bacteria | 6661 |
| 18 | Ga0466692_076940 | 3300042591 | Bacteria | 1499 |
| 19 | Ga0466691_160224 | 3300042593 | Bacteria | 27887 |
| 20 | Ga0466694_401835 | 3300042594 | Bacteria | 1188 |
| 21 | Ga0466696_313817 | 3300042596 | Bacteria | 3202 |
| 22 | Ga0466699_003147 | 3300042597 | Bacteria | 11966 |
| 23 | JGI24702J35022_10099885 | 3300002462 | Bacteria | 1587 |
| 24 | Ga0466705_456323 | 3300042612 | Bacteria | 1237 |
| 25 | Ga0466718_112058 | 3300042617 | Bacteria | 11480 |
| 26 | Ga0466723_308471 | 3300042618 | Bacteria | 3283 |
| 27 | Ga0466726_148765 | 3300042619 | Bacteria | 1212 |
| 28 | Ga0466705_319041 | 3300042612 | Bacteria | 4013 |
| 29 | Ga0466705_378209 | 3300042612 | Bacteria | 1328 |
| 30 | Ga0123353_10307644 | 3300010167 | Bacteria | 2414 |
| 31 | Ga0466703_159507 | 3300042636 | Bacteria | 4680 |
| 32 | Ga0466704_184155 | 3300042643 | Bacteria | 22496 |
| 33 | Ga0466727_200104 | 3300042655 | Bacteria | 1498 |
| 34 | Ga0466727_334365 | 3300042655 | Bacteria | 1070 |
| 35 | Ga0466706_253886 | 3300042599 | Bacteria | 1466 |
| 36 | Ga0466707_155305 | 3300042601 | Bacteria | 1382 |
| 37 | Ga0466716_079244 | 3300042605 | Bacteria | 4941 |
| 38 | Ga0466719_214145 | 3300042606 | Bacteria | 14765 |
| 39 | Ga0466690_010519 | 3300042590 | Bacteria | 9149 |
| 40 | Ga0466699_152904 | 3300042597 | Bacteria | 4959 |
| 41 | Ga0466699_415070 | 3300042597 | Bacteria | 13544 |
| 42 | Ga0072940_1055102 | 3300005200 | Bacteria | 8923 |
| 43 | Ga0466711_312664 | 3300042615 | Bacteria | 3391 |
| 44 | Ga0466726_045152 | 3300042619 | Unclassified | 1182 |
| 45 | Ga0466705_358346 | 3300042612 | Bacteria | 5915 |
| 46 | Ga0123353_10938094 | 3300010167 | Bacteria | 1172 |
| 47 | Ga0123353_11635011 | 3300010167 | Bacteria | 811 |
| 48 | Ga0123354_10500194 | 3300010882 | Bacteria | 948 |
| 49 | Ga0466704_187578 | 3300042643 | Bacteria | 5718 |
| 50 | Ga0466708_158227 | 3300042652 | Bacteria | 13373 |
| 51 | Ga0415639_089702 | 3300038395 | Bacteria | 1952 |
| 52 | Ga0466691_007974 | 3300042593 | Bacteria | 2781 |
| 53 | Ga0466699_221293 | 3300042597 | Bacteria | 4744 |
| 54 | Ga0466699_431518 | 3300042597 | Bacteria | 1091 |
| 55 | Ga0466699_432669 | 3300042597 | Bacteria | 1786 |
| 56 | Ga0466711_025099 | 3300042615 | Bacteria | 2732 |
| 57 | Ga0466726_258208 | 3300042619 | Bacteria | 2152 |
| 58 | Ga0466728_062089 | 3300042620 | Bacteria | 1309 |
| 59 | Ga0466728_110092 | 3300042620 | Bacteria | 1760 |
| 60 | Ga0123357_10037218 | 3300009784 | Bacteria | 6622 |
| 61 | Ga0123357_10102738 | 3300009784 | Bacteria | 3679 |
| 62 | Ga0466703_021317 | 3300042636 | Bacteria | 5222 |
| 63 | Ga0466709_239150 | 3300042648 | Bacteria | 19698 |
| 64 | Ga0466727_249854 | 3300042655 | Bacteria | 1460 |
| 65 | Ga0466716_406417 | 3300042605 | Bacteria | 13086 |
| 66 | Ga0466719_337352 | 3300042606 | Bacteria | 57418 |
| 67 | Ga0466691_140216 | 3300042593 | Bacteria | 2299 |
| 68 | Ga0466694_001593 | 3300042594 | Bacteria | 1836 |
| 69 | JGI24702J35022_10029369 | 3300002462 | Bacteria | 2951 |
| 70 | Ga0466715_024200 | 3300042616 | Bacteria | 4210 |
| 71 | Ga0466715_069397 | 3300042616 | Bacteria | 3260 |
| 72 | Ga0466723_043161 | 3300042618 | Bacteria | 40432 |
| 73 | Ga0466723_134214 | 3300042618 | Unclassified | 7172 |
| 74 | Ga0466723_300472 | 3300042618 | Bacteria | 3061 |
| 75 | Ga0466726_448041 | 3300042619 | Bacteria | 1181 |
| 76 | Ga0466735_104944 | 3300042624 | Bacteria | 3372 |
| 77 | Ga0466735_172139 | 3300042624 | Bacteria | 8462 |
| 78 | Ga0466708_440932 | 3300042652 | Bacteria | 3315 |
| 79 | Ga0466707_313450 | 3300042601 | Unclassified | 1389 |
| 80 | Ga0466722_226891 | 3300042609 | Bacteria | 5560 |
| 81 | Ga0466694_219456 | 3300042594 | Bacteria | 4167 |
| 82 | Ga0466696_506773 | 3300042596 | Bacteria | 1681 |
| 83 | Ga0466718_163569 | 3300042617 | Bacteria | 6340 |
| 84 | Ga0466705_041456 | 3300042612 | Bacteria | 4438 |
| 85 | Ga0466735_226872 | 3300042624 | Bacteria | 18732 |
| 86 | Ga0466704_075692 | 3300042643 | Bacteria | 1750 |
| 87 | Ga0466704_259007 | 3300042643 | Unclassified | 1033 |
| 88 | Ga0466704_478969 | 3300042643 | Bacteria | 4850 |
| 89 | Ga0466704_518292 | 3300042643 | Bacteria | 1051 |
| 90 | Ga0466709_253041 | 3300042648 | Bacteria | 6731 |
| 91 | Ga0466708_211425 | 3300042652 | Bacteria | 37566 |
| 92 | Ga0466727_320655 | 3300042655 | Bacteria | 1539 |
| 93 | Ga0466719_280145 | 3300042606 | Bacteria | 1070 |
| 94 | Ga0466722_017662 | 3300042609 | Bacteria | 38711 |
| 95 | Ga0466690_387688 | 3300042590 | Bacteria | 3617 |
| 96 | Ga0466691_227529 | 3300042593 | Bacteria | 10220 |
| 97 | Ga0466694_006688 | 3300042594 | Unclassified | 6473 |
| 98 | Ga0466696_096650 | 3300042596 | Bacteria | 2890 |
| 99 | Ga0466712_132244 | 3300042614 | Bacteria | 2676 |
| 100 | Ga0466715_243154 | 3300042616 | Bacteria | 10228 |
| 101 | Ga0466726_487735 | 3300042619 | Bacteria | 2748 |
| 102 | Ga0466728_473942 | 3300042620 | Bacteria | 11204 |
| 103 | Ga0123353_11541020 | 3300010167 | Bacteria | 844 |
| 104 | Ga0123354_10221840 | 3300010882 | Bacteria | 2005 |
| 105 | Ga0466703_051255 | 3300042636 | Bacteria | 36806 |
| 106 | Ga0466703_058395 | 3300042636 | Bacteria | 2462 |
| 107 | Ga0466719_508270 | 3300042606 | Bacteria | 2284 |
| 108 | Ga0466722_154420 | 3300042609 | Bacteria | 6072 |
| 109 | Ga0466691_100346 | 3300042593 | Bacteria | 6161 |
| 110 | JGI24705J35276_12217636 | 3300002504 | Bacteria | 2103 |
| 111 | Ga0072940_1052029 | 3300005200 | Bacteria | 2262 |
| 112 | Ga0466711_161331 | 3300042615 | Bacteria | 2811 |
| 113 | Ga0466715_424953 | 3300042616 | Bacteria | 7184 |
| 114 | Ga0466728_073407 | 3300042620 | Bacteria | 2195 |
| 115 | Ga0466728_211763 | 3300042620 | Bacteria | 16217 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01812 | 5-FTHF_cyc-lig | 5-formyltetrahydrofolate cyclo-ligase family | 9 | 210 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.