Protein Family IF00875
Metagenome
Isolate
127
Members
44
Samples
126
Scaffolds
235.36
Avg Length
Representative Sequence
- ID
- 3300002504|JGI24705J35276_12199301|JGI24705J35276_121993011
- Length
- 270 aa
- Sequence
- MPPLKILFLTERVITQHKPLTGYPQDLRQYTDIYKEEKSMLNRKTFFILAVILFLGVSGLWAGDTATFVDLGFSPDGRIYMFAQYGVQSKTLKPWAELFVVDVPMNNFVNGGRLSYTHDTSVVSGQDGSGALYRIIARNSSIAERHQVNYCFQGQPLYIALDGTAPTEAEFRDFDNGASYRASLVSYAEGSGASLKSSFHINLERTARDGTRKAYTVGTPQLKRPLIASYRIKKVMIAPYDGSMIFVIEMKKQEGADFDIRYMVEAVRL*
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.8%
Kalotermitidae
32.6%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Unclassified
4.7%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_036104 | 3300042659 | Bacteria | 5760 |
| 2 | Ga0466720_077730 | 3300042607 | Bacteria | 2655 |
| 3 | Ga0466694_040298 | 3300042594 | Bacteria | 14270 |
| 4 | Ga0466694_372346 | 3300042594 | Unclassified | 2056 |
| 5 | Ga0466696_013467 | 3300042596 | Bacteria | 1527 |
| 6 | Ga0466711_013903 | 3300042615 | Bacteria | 8118 |
| 7 | Ga0466711_100242 | 3300042615 | Bacteria | 5339 |
| 8 | Ga0466723_213352 | 3300042618 | Bacteria | 2447 |
| 9 | Ga0466726_047810 | 3300042619 | Bacteria | 3141 |
| 10 | Ga0123353_10390838 | 3300010167 | Bacteria | 2075 |
| 11 | JGI24695J34938_10121136 | 3300002450 | Bacteria | 1065 |
| 12 | JGI24702J35022_10062013 | 3300002462 | Bacteria | 2001 |
| 13 | JGI24705J35276_12162031 | 3300002504 | Bacteria | 1238 |
| 14 | Ga0466703_354559 | 3300042636 | Bacteria | 1122 |
| 15 | Ga0466704_190705 | 3300042643 | Bacteria | 4706 |
| 16 | Ga0466708_351532 | 3300042652 | Bacteria | 7534 |
| 17 | Ga0466708_411639 | 3300042652 | Bacteria | 5715 |
| 18 | Ga0466708_415102 | 3300042652 | Bacteria | 2416 |
| 19 | Ga0466705_162398 | 3300042612 | Bacteria | 6789 |
| 20 | Ga0466733_184845 | 3300042659 | Bacteria | 1421 |
| 21 | Ga0415639_114239 | 3300038395 | Bacteria | 3854 |
| 22 | Ga0466690_367691 | 3300042590 | Bacteria | 6739 |
| 23 | Ga0466691_013770 | 3300042593 | Bacteria | 3389 |
| 24 | Ga0466723_099609 | 3300042618 | Bacteria | 1909 |
| 25 | Ga0466726_419710 | 3300042619 | Bacteria | 1121 |
| 26 | Ga0466728_101926 | 3300042620 | Bacteria | 1752 |
| 27 | Ga0466728_452306 | 3300042620 | Bacteria | 5166 |
| 28 | Ga0123353_10284929 | 3300010167 | Bacteria | 2534 |
| 29 | Ga0123353_10373646 | 3300010167 | Bacteria | 2136 |
| 30 | Ga0123353_10780023 | 3300010167 | Bacteria | 1324 |
| 31 | Ga0123354_10452860 | 3300010882 | Bacteria | 1038 |
| 32 | Ga0072940_1038243 | 3300005200 | Bacteria | 3777 |
| 33 | Ga0466727_209865 | 3300042655 | Bacteria | 1441 |
| 34 | Ga0466705_238594 | 3300042612 | Bacteria | 4988 |
| 35 | Ga0466705_241522 | 3300042612 | Bacteria | 6288 |
| 36 | Ga0466700_024998 | 3300042600 | Bacteria | 3151 |
| 37 | Ga0466700_126316 | 3300042600 | Bacteria | 1815 |
| 38 | Ga0265387_1030995 | 3300024582 | Bacteria | 866 |
| 39 | Ga0466690_303131 | 3300042590 | Bacteria | 5294 |
| 40 | Ga0466696_480663 | 3300042596 | Bacteria | 3756 |
| 41 | Ga0466718_054600 | 3300042617 | Bacteria | 1177 |
| 42 | Ga0466723_042112 | 3300042618 | Bacteria | 9026 |
| 43 | Ga0466723_148893 | 3300042618 | Bacteria | 1260 |
| 44 | Ga0123353_10397674 | 3300010167 | Bacteria | 2052 |
| 45 | Ga0466735_028648 | 3300042624 | Bacteria | 1691 |
| 46 | Ga0466735_201210 | 3300042624 | Bacteria | 3016 |
| 47 | Ga0466709_237024 | 3300042648 | Bacteria | 3797 |
| 48 | Ga0466709_317002 | 3300042648 | Bacteria | 7009 |
| 49 | Ga0466708_100401 | 3300042652 | Bacteria | 3869 |
| 50 | Ga0466732_248001 | 3300042656 | Bacteria | 2917 |
| 51 | Ga0466733_045722 | 3300042659 | Bacteria | 6159 |
| 52 | Ga0466733_118068 | 3300042659 | Bacteria | 1285 |
| 53 | Ga0466720_140830 | 3300042607 | Bacteria | 1531 |
| 54 | Ga0466692_168340 | 3300042591 | Bacteria | 9709 |
| 55 | Ga0466691_080416 | 3300042593 | Bacteria | 1641 |
| 56 | Ga0466694_343704 | 3300042594 | Bacteria | 1818 |
| 57 | Ga0466699_185399 | 3300042597 | Bacteria | 1558 |
| 58 | Ga0466705_529205 | 3300042612 | Bacteria | 14793 |
| 59 | Ga0466712_126598 | 3300042614 | Bacteria | 10694 |
| 60 | Ga0466715_186577 | 3300042616 | Bacteria | 3852 |
| 61 | Ga0466715_271261 | 3300042616 | Bacteria | 5364 |
| 62 | Ga0466715_500799 | 3300042616 | Bacteria | 3547 |
| 63 | Ga0466723_084546 | 3300042618 | Bacteria | 4945 |
| 64 | Ga0466728_105419 | 3300042620 | Bacteria | 5134 |
| 65 | JGI24705J35276_11962514 | 3300002504 | Bacteria | 806 |
| 66 | JGI24705J35276_12199301 | 3300002504 | Bacteria | 1583 |
| 67 | Ga0466704_037688 | 3300042643 | Bacteria | 2554 |
| 68 | Ga0466709_035429 | 3300042648 | Bacteria | 8310 |
| 69 | Ga0466708_169734 | 3300042652 | Bacteria | 12525 |
| 70 | Ga0466700_084854 | 3300042600 | Bacteria | 1014 |
| 71 | Ga0466719_126287 | 3300042606 | Bacteria | 2953 |
| 72 | Ga0466722_182543 | 3300042609 | Bacteria | 3669 |
| 73 | Ga0466690_095862 | 3300042590 | Bacteria | 3416 |
| 74 | Ga0466691_080851 | 3300042593 | Bacteria | 5272 |
| 75 | Ga0466694_276330 | 3300042594 | Bacteria | 2162 |
| 76 | Ga0466695_236747 | 3300042595 | Bacteria | 8304 |
| 77 | Ga0466711_041085 | 3300042615 | Bacteria | 2535 |
| 78 | Ga0466715_017351 | 3300042616 | Bacteria | 2852 |
| 79 | Ga0466723_020453 | 3300042618 | Bacteria | 3201 |
| 80 | Ga0466723_035164 | 3300042618 | Bacteria | 5075 |
| 81 | Ga0123357_10133786 | 3300009784 | Bacteria | 3075 |
| 82 | Ga0123356_11378728 | 3300010049 | Bacteria | 866 |
| 83 | Ga0123353_10092526 | 3300010167 | Bacteria | 4871 |
| 84 | Ga0123353_10515508 | 3300010167 | Bacteria | 1737 |
| 85 | AustNasuHG_c1024681 | 3300000089 | Bacteria | 1900 |
| 86 | Ga0466729_280095 | 3300042621 | Bacteria | 2030 |
| 87 | Ga0466716_030935 | 3300042605 | Unclassified | 1972 |
| 88 | Ga0466722_220685 | 3300042609 | Bacteria | 4486 |
| 89 | Ga0466690_000748 | 3300042590 | Bacteria | 2907 |
| 90 | Ga0466692_062240 | 3300042591 | Bacteria | 3313 |
| 91 | Ga0466696_281347 | 3300042596 | Bacteria | 1615 |
| 92 | Ga0466699_372512 | 3300042597 | Bacteria | 1545 |
| 93 | Ga0466715_368617 | 3300042616 | Bacteria | 16621 |
| 94 | Ga0466726_222395 | 3300042619 | Bacteria | 14721 |
| 95 | Ga0123357_10077351 | 3300009784 | Bacteria | 4390 |
| 96 | Ga0123353_10009250 | 3300010167 | Bacteria | 13565 |
| 97 | Ga0123354_10550511 | 3300010882 | Bacteria | 870 |
| 98 | Ga0466703_177046 | 3300042636 | Bacteria | 1528 |
| 99 | Ga0466704_241861 | 3300042643 | Bacteria | 1610 |
| 100 | Ga0466709_347680 | 3300042648 | Bacteria | 22254 |
| 101 | Ga0466733_072759 | 3300042659 | Bacteria | 51080 |
| 102 | Ga0466701_089597 | 3300042598 | Bacteria | 1551 |
| 103 | Ga0466707_017379 | 3300042601 | Unclassified | 1655 |
| 104 | Ga0466707_046768 | 3300042601 | Bacteria | 2061 |
| 105 | Ga0466707_349564 | 3300042601 | Bacteria | 4362 |
| 106 | Ga0466698_129051 | 3300042610 | Bacteria | 1907 |
| 107 | Ga0415639_089951 | 3300038395 | Bacteria | 1113 |
| 108 | Ga0466699_026176 | 3300042597 | Bacteria | 1150 |
| 109 | Ga0466723_112307 | 3300042618 | Bacteria | 2661 |
| 110 | Ga0123357_10208486 | 3300009784 | Bacteria | 2203 |
| 111 | Ga0466735_096310 | 3300042624 | Bacteria | 5766 |
| 112 | Ga0466703_015250 | 3300042636 | Bacteria | 1691 |
| 113 | Ga0466709_313719 | 3300042648 | Bacteria | 10898 |
| 114 | Ga0466732_425518 | 3300042656 | Bacteria | 3857 |
| 115 | Ga0466690_303813 | 3300042590 | Bacteria | 1710 |
| 116 | Ga0466691_018434 | 3300042593 | Bacteria | 1681 |
| 117 | Ga0466691_068742 | 3300042593 | Bacteria | 1737 |
| 118 | Ga0466691_150143 | 3300042593 | Bacteria | 5110 |
| 119 | Ga0466699_006676 | 3300042597 | Bacteria | 1327 |
| 120 | Ga0466699_169832 | 3300042597 | Bacteria | 2674 |
| 121 | Ga0466726_108417 | 3300042619 | Bacteria | 5729 |
| 122 | JGI24702J35022_10003075 | 3300002462 | Bacteria | 10091 |
| 123 | Ga0466735_038589 | 3300042624 | Bacteria | 5141 |
| 124 | Ga0466703_180190 | 3300042636 | Bacteria | 1116 |
| 125 | Ga0466704_302300 | 3300042643 | Bacteria | 26778 |
| 126 | Ga0466709_071557 | 3300042648 | Bacteria | 14177 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10016 | DUF2259 | Predicted secreted protein (DUF2259) | 82 | 268 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.