Protein Family IF00753
Metagenome
Isolate
137
Members
55
Samples
127
Scaffolds
324.49
Avg Length
Representative Sequence
- ID
- 3300002462|JGI24702J35022_10001569|JGI24702J35022_1000156912
- Length
- 356 aa
- Sequence
- MTTLRRFNCRTMTGKTNAFKAWLFLGPEIGEKESAIKEIRKNLSSFGDVLSGEEKLSPGERFSSGGLEETVYYTGETTVSTMISHMRNGSLFAEKRLFIVKCAEGIKKKEDIDQLTSFIESPPDDTYLIMISEETSISKGIEKLVSPANKRIFWELSDSRKYEWVENFFRKEGFRIREDGIETILELVENNTAALKQECSRLTLFLERNSEISGEAAEKWLSHTRQESAFTLFSRIASGDLSRSLESMNVLLAAKEALPAIFAGLASCFRKLMNYLALKEEGVTDEAEFRKIGVSSPGAKRDYAAAGRRYNSASAETCLALTAEYDLLTRASGTFPEQILMNKYLYKIHSLGRSS*
Sample Types
Isolate
7.3%
Metagenome
92.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Unclassified
24.1%
Kalotermitidae
24.1%
Termopsidae
5.6%
Rhinotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 25 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 26 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 27 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 50 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 51 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_279577 | 3300042612 | Bacteria | 6850 |
| 2 | Ga0466732_070212 | 3300042656 | Bacteria | 1803 |
| 3 | Ga0466713_137258 | 3300042602 | Bacteria | 18449 |
| 4 | Ga0466719_319877 | 3300042606 | Bacteria | 19932 |
| 5 | Ga0466720_008714 | 3300042607 | Bacteria | 1061 |
| 6 | Ga0264413_111309 | 3300024493 | Bacteria | 7926 |
| 7 | Ga0264413_119270 | 3300024493 | Bacteria | 6965 |
| 8 | Ga0415639_061296 | 3300038395 | Bacteria | 2561 |
| 9 | Ga0466691_106718 | 3300042593 | Bacteria | 5741 |
| 10 | Ga0466694_328262 | 3300042594 | Bacteria | 1358 |
| 11 | Ga0123357_10006128 | 3300009784 | Bacteria | 14575 |
| 12 | Ga0123355_10012785 | 3300009826 | Bacteria | 13021 |
| 13 | Ga0123356_10001263 | 3300010049 | Bacteria | 27963 |
| 14 | Ga0123356_10003357 | 3300010049 | Bacteria | 16808 |
| 15 | Ga0123356_10296274 | 3300010049 | Bacteria | 1720 |
| 16 | Ga0123353_10081851 | 3300010167 | Bacteria | 5192 |
| 17 | Ga0123353_10213482 | 3300010167 | Bacteria | 3025 |
| 18 | Ga0466703_029348 | 3300042636 | Unclassified | 1909 |
| 19 | Ga0466715_131105 | 3300042616 | Bacteria | 7317 |
| 20 | Ga0466728_445193 | 3300042620 | Bacteria | 1916 |
| 21 | JGI24698J34947_10000176 | 3300002449 | Bacteria | 25045 |
| 22 | JGI24698J34947_10015087 | 3300002449 | Bacteria | 4208 |
| 23 | JGI24698J34947_10036599 | 3300002449 | Bacteria | 2555 |
| 24 | JGI24696J40584_12933501 | 3300002834 | Bacteria | 1521 |
| 25 | Ga0466705_302598 | 3300042612 | Bacteria | 16521 |
| 26 | Ga0466720_062583 | 3300042607 | Bacteria | 4842 |
| 27 | Ga0466722_031584 | 3300042609 | Bacteria | 7812 |
| 28 | Ga0466693_010539 | 3300042592 | Bacteria | 5654 |
| 29 | Ga0466691_094483 | 3300042593 | Bacteria | 7262 |
| 30 | Ga0466699_353545 | 3300042597 | Bacteria | 1871 |
| 31 | Ga0123357_10055817 | 3300009784 | Bacteria | 5315 |
| 32 | Ga0123353_10527404 | 3300010167 | Bacteria | 1711 |
| 33 | Ga0466702_222629 | 3300042635 | Bacteria | 24290 |
| 34 | Ga0466702_433430 | 3300042635 | Bacteria | 2740 |
| 35 | Ga0466708_451333 | 3300042652 | Bacteria | 2683 |
| 36 | Ga0466712_036762 | 3300042614 | Bacteria | 1529 |
| 37 | Ga0466712_264449 | 3300042614 | Bacteria | 6056 |
| 38 | Ga0466712_313477 | 3300042614 | Bacteria | 1140 |
| 39 | Ga0466726_476075 | 3300042619 | Bacteria | 7531 |
| 40 | JGI24695J34938_10007190 | 3300002450 | Bacteria | 6560 |
| 41 | Ga0415639_006422 | 3300038395 | Bacteria | 10172 |
| 42 | Ga0415639_109565 | 3300038395 | Bacteria | 5193 |
| 43 | Ga0466693_280231 | 3300042592 | Bacteria | 2751 |
| 44 | Ga0123353_10921796 | 3300010167 | Bacteria | 1186 |
| 45 | Ga0466704_497388 | 3300042643 | Bacteria | 17431 |
| 46 | Ga0466708_016160 | 3300042652 | Bacteria | 3462 |
| 47 | Ga0466712_050857 | 3300042614 | Bacteria | 1290 |
| 48 | Ga0466711_205735 | 3300042615 | Bacteria | 9670 |
| 49 | Ga0466718_038925 | 3300042617 | Bacteria | 6808 |
| 50 | Ga0466718_087021 | 3300042617 | Bacteria | 2236 |
| 51 | JGI24702J35022_10001569 | 3300002462 | Bacteria | 14183 |
| 52 | Ga0072940_1062240 | 3300005200 | Bacteria | 4392 |
| 53 | Ga0466707_269991 | 3300042601 | Bacteria | 2079 |
| 54 | Ga0466717_283189 | 3300042604 | Bacteria | 2745 |
| 55 | Ga0466720_118945 | 3300042607 | Bacteria | 2154 |
| 56 | Ga0466694_144046 | 3300042594 | Bacteria | 2009 |
| 57 | Ga0466695_063524 | 3300042595 | Bacteria | 5477 |
| 58 | Ga0123353_10130285 | 3300010167 | Bacteria | 4037 |
| 59 | Ga0466703_190093 | 3300042636 | Bacteria | 19996 |
| 60 | Ga0466712_313606 | 3300042614 | Bacteria | 6668 |
| 61 | Ga0466715_006809 | 3300042616 | Bacteria | 5592 |
| 62 | Ga0466715_363176 | 3300042616 | Bacteria | 18903 |
| 63 | Ga0466723_130260 | 3300042618 | Bacteria | 16358 |
| 64 | JGI24702J35022_10012677 | 3300002462 | Bacteria | 4679 |
| 65 | JGI24702J35022_10024385 | 3300002462 | Bacteria | 3269 |
| 66 | Ga0466719_271900 | 3300042606 | Bacteria | 9517 |
| 67 | Ga0466719_367260 | 3300042606 | Bacteria | 3991 |
| 68 | Ga0466720_093765 | 3300042607 | Bacteria | 4030 |
| 69 | Ga0466720_143539 | 3300042607 | Unclassified | 6735 |
| 70 | Ga0466694_161774 | 3300042594 | Bacteria | 11284 |
| 71 | Ga0466696_234330 | 3300042596 | Bacteria | 12112 |
| 72 | Ga0466699_031615 | 3300042597 | Bacteria | 11682 |
| 73 | Ga0123357_10014743 | 3300009784 | Bacteria | 10216 |
| 74 | Ga0123355_10010188 | 3300009826 | Bacteria | 14372 |
| 75 | Ga0123356_10063275 | 3300010049 | Bacteria | 3457 |
| 76 | Ga0466735_122506 | 3300042624 | Bacteria | 3724 |
| 77 | Ga0466702_422480 | 3300042635 | Bacteria | 2440 |
| 78 | Ga0466703_091936 | 3300042636 | Bacteria | 6841 |
| 79 | Ga0466703_169691 | 3300042636 | Bacteria | 3610 |
| 80 | Ga0466727_251095 | 3300042655 | Bacteria | 1943 |
| 81 | Ga0466715_141009 | 3300042616 | Bacteria | 2560 |
| 82 | Ga0466723_332444 | 3300042618 | Bacteria | 10301 |
| 83 | AustNasuHG_c1000426 | 3300000089 | Bacteria | 14673 |
| 84 | JGI24702J35022_10005183 | 3300002462 | Bacteria | 7643 |
| 85 | Ga0068305_10937443 | 3300005083 | Bacteria | 1545 |
| 86 | Ga0466693_255114 | 3300042592 | Bacteria | 1830 |
| 87 | Ga0466694_193076 | 3300042594 | Bacteria | 5880 |
| 88 | Ga0123357_10079827 | 3300009784 | Bacteria | 4306 |
| 89 | Ga0123353_10025163 | 3300010167 | Bacteria | 9061 |
| 90 | Ga0123353_10160990 | 3300010167 | Bacteria | 3573 |
| 91 | Ga0123354_10277109 | 3300010882 | Bacteria | 1637 |
| 92 | Ga0466704_606958 | 3300042643 | Bacteria | 82552 |
| 93 | Ga0466727_130923 | 3300042655 | Bacteria | 3567 |
| 94 | Ga0466727_163476 | 3300042655 | Bacteria | 6512 |
| 95 | Ga0466723_074053 | 3300042618 | Bacteria | 35080 |
| 96 | Ga0466726_065292 | 3300042619 | Bacteria | 1755 |
| 97 | JGI24698J34947_10004056 | 3300002449 | Bacteria | 7958 |
| 98 | Ga0466705_158129 | 3300042612 | Bacteria | 6320 |
| 99 | Ga0466701_021006 | 3300042598 | Bacteria | 1291 |
| 100 | Ga0466719_461106 | 3300042606 | Bacteria | 1642 |
| 101 | Ga0415639_018644 | 3300038395 | Bacteria | 2918 |
| 102 | Ga0466690_121355 | 3300042590 | Bacteria | 3572 |
| 103 | Ga0466690_431538 | 3300042590 | Bacteria | 2447 |
| 104 | Ga0466694_386807 | 3300042594 | Bacteria | 1626 |
| 105 | Ga0466694_409101 | 3300042594 | Bacteria | 1363 |
| 106 | Ga0123353_10086183 | 3300010167 | Bacteria | 5058 |
| 107 | Ga0123353_10182331 | 3300010167 | Bacteria | 3322 |
| 108 | Ga0123354_10099735 | 3300010882 | Bacteria | 3938 |
| 109 | Ga0466734_062874 | 3300042623 | Bacteria | 1777 |
| 110 | Ga0466704_181864 | 3300042643 | Bacteria | 34471 |
| 111 | Ga0466709_068755 | 3300042648 | Bacteria | 5487 |
| 112 | Ga0466709_160299 | 3300042648 | Bacteria | 9974 |
| 113 | JGI24698J34947_10002878 | 3300002449 | Bacteria | 9331 |
| 114 | Ga0466707_223984 | 3300042601 | Bacteria | 9861 |
| 115 | Ga0466696_308560 | 3300042596 | Bacteria | 3028 |
| 116 | Ga0466696_357715 | 3300042596 | Bacteria | 2595 |
| 117 | Ga0466699_049870 | 3300042597 | Bacteria | 2169 |
| 118 | Ga0123353_11270176 | 3300010167 | Bacteria | 959 |
| 119 | Ga0466712_010679 | 3300042614 | Bacteria | 17309 |
| 120 | Ga0466712_123191 | 3300042614 | Bacteria | 3448 |
| 121 | Ga0466711_038275 | 3300042615 | Bacteria | 4911 |
| 122 | Ga0466711_246502 | 3300042615 | Bacteria | 18201 |
| 123 | Ga0466715_032602 | 3300042616 | Bacteria | 1168 |
| 124 | Ga0466718_068861 | 3300042617 | Archaea | 2132 |
| 125 | Ga0466718_109762 | 3300042617 | Bacteria | 2229 |
| 126 | Ga0466726_023806 | 3300042619 | Bacteria | 1776 |
| 127 | Ga0466726_061852 | 3300042619 | Bacteria | 1298 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF21694 | DNA_pol3_delta_C | DNA polymerase III delta subunit, C-terminal domain | 227 | 330 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.