Protein Family IF00689
Metagenome
Isolate
190
Members
60
Samples
174
Scaffolds
447.81
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10029987|JGI24695J34938_100299872
- Length
- 483 aa
- Sequence
- MIVMKFGGSSVADASRLRHVAEIVKTQLLRKPVLVLSAMGDTTDHLLEAGDTALKEGKVQIKHVEKLHLDTMKSLKLTSKNEIGDLMNELSRLLSGIALIRELTPRTRDFLVSFGERLSVRIAASYLKSIKINAKAFDAWEMGFLSNSNFTHAELLKESWELIPAKIQQQVKGNVLPVVTGFLAKDERGNITTLGRGGSDLSATMIAAACMAEEVQVWKDVDGILTADPRIVKNARPVNHVTYEEASELAYFGAQVLHPRAMQPCMKTGTPVLVKNSYNTEAPGTRIGHAAAGQKKGASVPTAKLPAVRAITAKQKVTLIDIVSTRMLGQYGFLAEVFSIFSKYNISVDMVATSEVSVSLTLDNAYDLTDVKRELNRIASVEIKTXNAIISIIGNVKRSSEILARAFRICQLIGVPVQMVSQGASKVNVSFIVSDDEAEEVIKALHMDFFDSQEITRRRADDAKETHTGGNRVGGTASSGVS*
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Unclassified
31.0%
Kalotermitidae
22.4%
Rhinotermitidae
5.2%
Termopsidae
3.4%
Taxonomy
Archaea
0
Bacteria
175
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 8 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 19 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 27 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 28 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 29 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 39 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 40 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 53 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10265860 | 3300010167 | Bacteria | 2646 |
| 2 | Ga0466707_085867 | 3300042601 | Bacteria | 2849 |
| 3 | Ga0466720_094550 | 3300042607 | Bacteria | 11389 |
| 4 | Ga0466722_039060 | 3300042609 | Bacteria | 4606 |
| 5 | Ga0466722_046420 | 3300042609 | Bacteria | 5574 |
| 6 | Ga0466722_108788 | 3300042609 | Bacteria | 15261 |
| 7 | Ga0466722_254680 | 3300042609 | Bacteria | 1731 |
| 8 | AustNasuHG_c1029534 | 3300000089 | Unclassified | 1602 |
| 9 | JGI24698J34947_10003806 | 3300002449 | Bacteria | 8220 |
| 10 | JGI24695J34938_10025457 | 3300002450 | Bacteria | 2828 |
| 11 | JGI24702J35022_10001216 | 3300002462 | Bacteria | 16016 |
| 12 | Ga0072941_1009157 | 3300005201 | Bacteria | 5940 |
| 13 | Ga0264413_105378 | 3300024493 | Bacteria | 3409 |
| 14 | Ga0415639_004195 | 3300038395 | Bacteria | 8584 |
| 15 | Ga0466692_147413 | 3300042591 | Bacteria | 20784 |
| 16 | Ga0466691_105208 | 3300042593 | Bacteria | 3132 |
| 17 | Ga0466694_087301 | 3300042594 | Bacteria | 37116 |
| 18 | Ga0466694_185074 | 3300042594 | Bacteria | 6719 |
| 19 | Ga0466699_184779 | 3300042597 | Bacteria | 1755 |
| 20 | Ga0466729_268891 | 3300042621 | Bacteria | 2098 |
| 21 | Ga0466703_357727 | 3300042636 | Bacteria | 32158 |
| 22 | Ga0466727_325218 | 3300042655 | Bacteria | 5229 |
| 23 | Ga0466718_021161 | 3300042617 | Bacteria | 4859 |
| 24 | Ga0466728_045124 | 3300042620 | Bacteria | 8634 |
| 25 | Ga0123356_10000020 | 3300010049 | Bacteria | 177064 |
| 26 | Ga0123356_10000309 | 3300010049 | Bacteria | 55893 |
| 27 | Ga0123356_10000381 | 3300010049 | Bacteria | 50607 |
| 28 | Ga0123356_10004948 | 3300010049 | Unclassified | 13663 |
| 29 | Ga0123356_10017436 | 3300010049 | Bacteria | 6832 |
| 30 | Ga0123356_10283240 | 3300010049 | Unclassified | 1754 |
| 31 | Ga0123356_10325861 | 3300010049 | Bacteria | 1651 |
| 32 | Ga0466707_113977 | 3300042601 | Bacteria | 3111 |
| 33 | Ga0466716_108798 | 3300042605 | Bacteria | 11445 |
| 34 | Ga0466716_393604 | 3300042605 | Bacteria | 3318 |
| 35 | Ga0466721_209094 | 3300042608 | Bacteria | 15941 |
| 36 | JGI24695J34938_10003435 | 3300002450 | Unclassified | 11079 |
| 37 | JGI24695J34938_10004008 | 3300002450 | Bacteria | 9911 |
| 38 | JGI24695J34938_10032795 | 3300002450 | Unclassified | 2396 |
| 39 | Ga0072941_1001715 | 3300005201 | Bacteria | 25527 |
| 40 | Ga0264413_105374 | 3300024493 | Bacteria | 7614 |
| 41 | Ga0466691_011938 | 3300042593 | Bacteria | 24022 |
| 42 | Ga0466696_019433 | 3300042596 | Bacteria | 8031 |
| 43 | Ga0466699_041352 | 3300042597 | Bacteria | 4408 |
| 44 | Ga0466705_046514 | 3300042612 | Bacteria | 4407 |
| 45 | Ga0466705_335442 | 3300042612 | Bacteria | 4889 |
| 46 | Ga0466703_109417 | 3300042636 | Bacteria | 11855 |
| 47 | Ga0466704_030655 | 3300042643 | Bacteria | 5927 |
| 48 | Ga0466704_106254 | 3300042643 | Bacteria | 14515 |
| 49 | Ga0466712_110435 | 3300042614 | Bacteria | 9073 |
| 50 | Ga0466718_115643 | 3300042617 | Bacteria | 2083 |
| 51 | Ga0466718_130959 | 3300042617 | Unclassified | 4647 |
| 52 | Ga0123356_10005342 | 3300010049 | Bacteria | 13095 |
| 53 | Ga0123356_10006830 | 3300010049 | Bacteria | 11479 |
| 54 | Ga0466719_256363 | 3300042606 | Bacteria | 6337 |
| 55 | JGI24698J34947_10001581 | 3300002449 | Bacteria | 12069 |
| 56 | JGI24698J34947_10013062 | 3300002449 | Bacteria | 4537 |
| 57 | JGI24698J34947_10017287 | 3300002449 | Bacteria | 3910 |
| 58 | Ga0072941_1006174 | 3300005201 | Bacteria | 10240 |
| 59 | Ga0072941_1028792 | 3300005201 | Bacteria | 8390 |
| 60 | Ga0264413_105376 | 3300024493 | Unclassified | 1391 |
| 61 | Ga0466692_009167 | 3300042591 | Bacteria | 2885 |
| 62 | Ga0466694_039131 | 3300042594 | Bacteria | 11291 |
| 63 | Ga0466699_038021 | 3300042597 | Bacteria | 1568 |
| 64 | Ga0466699_316695 | 3300042597 | Bacteria | 7985 |
| 65 | Ga0466702_096707 | 3300042635 | Bacteria | 10381 |
| 66 | Ga0466703_089491 | 3300042636 | Bacteria | 12307 |
| 67 | Ga0466703_300871 | 3300042636 | Bacteria | 15230 |
| 68 | Ga0466709_156194 | 3300042648 | Bacteria | 4433 |
| 69 | Ga0466708_009773 | 3300042652 | Bacteria | 7263 |
| 70 | Ga0466708_191293 | 3300042652 | Bacteria | 2008 |
| 71 | Ga0466711_313458 | 3300042615 | Bacteria | 16692 |
| 72 | Ga0466715_643038 | 3300042616 | Bacteria | 11072 |
| 73 | Ga0466718_081719 | 3300042617 | Bacteria | 8245 |
| 74 | Ga0466732_049350 | 3300042656 | Bacteria | 17877 |
| 75 | Ga0123357_10004871 | 3300009784 | Bacteria | 15912 |
| 76 | Ga0123357_10009188 | 3300009784 | Bacteria | 12453 |
| 77 | AustNasuHG_c1027116 | 3300000089 | Bacteria | 1761 |
| 78 | JGI24698J34947_10014215 | 3300002449 | Bacteria | 4335 |
| 79 | JGI24695J34938_10000409 | 3300002450 | Bacteria | 41862 |
| 80 | JGI24695J34938_10000777 | 3300002450 | Bacteria | 29893 |
| 81 | Ga0264413_114332 | 3300024493 | Bacteria | 7013 |
| 82 | Ga0466690_253130 | 3300042590 | Bacteria | 1920 |
| 83 | Ga0466694_043546 | 3300042594 | Bacteria | 51657 |
| 84 | Ga0466702_017222 | 3300042635 | Bacteria | 2319 |
| 85 | Ga0466703_151881 | 3300042636 | Bacteria | 15857 |
| 86 | Ga0466704_075394 | 3300042643 | Bacteria | 5214 |
| 87 | Ga0466712_075344 | 3300042614 | Bacteria | 6514 |
| 88 | Ga0466711_170323 | 3300042615 | Bacteria | 26815 |
| 89 | Ga0466716_514934 | 3300042605 | Bacteria | 12407 |
| 90 | JGI24695J34938_10030505 | 3300002450 | Unclassified | 2510 |
| 91 | Ga0072941_1008455 | 3300005201 | Unclassified | 8180 |
| 92 | Ga0072941_1010098 | 3300005201 | Bacteria | 12642 |
| 93 | Ga0072941_1038643 | 3300005201 | Unclassified | 4454 |
| 94 | Ga0072941_1052828 | 3300005201 | Bacteria | 8443 |
| 95 | Ga0466693_236340 | 3300042592 | Bacteria | 5925 |
| 96 | Ga0466694_095867 | 3300042594 | Bacteria | 7046 |
| 97 | Ga0466708_192647 | 3300042652 | Bacteria | 13214 |
| 98 | Ga0466712_081472 | 3300042614 | Bacteria | 9937 |
| 99 | Ga0466712_110696 | 3300042614 | Bacteria | 9397 |
| 100 | Ga0466712_237055 | 3300042614 | Bacteria | 8126 |
| 101 | Ga0466711_425921 | 3300042615 | Bacteria | 4837 |
| 102 | Ga0466715_260123 | 3300042616 | Bacteria | 6541 |
| 103 | Ga0123355_10153952 | 3300009826 | Bacteria | 3483 |
| 104 | Ga0123356_10046807 | 3300010049 | Bacteria | 4025 |
| 105 | Ga0123356_10189010 | 3300010049 | Bacteria | 2088 |
| 106 | Ga0123353_10024058 | 3300010167 | Bacteria | 9236 |
| 107 | Ga0466707_209513 | 3300042601 | Bacteria | 3077 |
| 108 | Ga0466713_024032 | 3300042602 | Bacteria | 10122 |
| 109 | JGI24698J34947_10002680 | 3300002449 | Bacteria | 9605 |
| 110 | JGI24698J34947_10002803 | 3300002449 | Bacteria | 9448 |
| 111 | JGI24698J34947_10012004 | 3300002449 | Bacteria | 4756 |
| 112 | JGI24695J34938_10000193 | 3300002450 | Bacteria | 56989 |
| 113 | JGI24695J34938_10007211 | 3300002450 | Bacteria | 6550 |
| 114 | Ga0264413_102688 | 3300024493 | Bacteria | 16329 |
| 115 | Ga0264413_105377 | 3300024493 | Bacteria | 16111 |
| 116 | Ga0466690_196141 | 3300042590 | Bacteria | 3732 |
| 117 | Ga0466696_082732 | 3300042596 | Bacteria | 35201 |
| 118 | Ga0466696_239440 | 3300042596 | Bacteria | 7438 |
| 119 | Ga0466703_036743 | 3300042636 | Bacteria | 2499 |
| 120 | Ga0466703_332679 | 3300042636 | Bacteria | 2918 |
| 121 | Ga0466704_168570 | 3300042643 | Bacteria | 7098 |
| 122 | Ga0466708_290187 | 3300042652 | Bacteria | 2922 |
| 123 | Ga0466712_022351 | 3300042614 | Bacteria | 12522 |
| 124 | Ga0466712_043338 | 3300042614 | Bacteria | 16062 |
| 125 | Ga0466712_048199 | 3300042614 | Bacteria | 9394 |
| 126 | Ga0466712_267773 | 3300042614 | Bacteria | 21070 |
| 127 | Ga0466712_275466 | 3300042614 | Bacteria | 8397 |
| 128 | Ga0466712_303680 | 3300042614 | Unclassified | 5555 |
| 129 | Ga0466715_052824 | 3300042616 | Bacteria | 4703 |
| 130 | Ga0466715_158411 | 3300042616 | Bacteria | 4334 |
| 131 | Ga0466718_012362 | 3300042617 | Bacteria | 6106 |
| 132 | Ga0466728_143566 | 3300042620 | Bacteria | 9815 |
| 133 | Ga0123356_10001153 | 3300010049 | Bacteria | 29214 |
| 134 | Ga0123356_10004991 | 3300010049 | Bacteria | 13608 |
| 135 | Ga0123356_10183389 | 3300010049 | Bacteria | 2117 |
| 136 | Ga0466716_421837 | 3300042605 | Bacteria | 15632 |
| 137 | Ga0466720_055247 | 3300042607 | Bacteria | 8806 |
| 138 | Ga0466722_206051 | 3300042609 | Bacteria | 7157 |
| 139 | Ga0466698_195093 | 3300042610 | Bacteria | 7942 |
| 140 | AustNasuHG_c1000283 | 3300000089 | Bacteria | 17536 |
| 141 | JGI24695J34938_10002913 | 3300002450 | Bacteria | 12428 |
| 142 | JGI24695J34938_10009000 | 3300002450 | Bacteria | 5612 |
| 143 | JGI24695J34938_10012307 | 3300002450 | Bacteria | 4543 |
| 144 | JGI24695J34938_10014435 | 3300002450 | Unclassified | 4095 |
| 145 | JGI24695J34938_10029987 | 3300002450 | Bacteria | 2538 |
| 146 | Ga0072940_1011464 | 3300005200 | Bacteria | 16664 |
| 147 | Ga0072941_1006176 | 3300005201 | Bacteria | 10152 |
| 148 | Ga0072941_1027704 | 3300005201 | Bacteria | 3490 |
| 149 | Ga0415639_055315 | 3300038395 | Bacteria | 10873 |
| 150 | Ga0466692_191519 | 3300042591 | Bacteria | 3584 |
| 151 | Ga0466696_232758 | 3300042596 | Bacteria | 6181 |
| 152 | Ga0466702_244839 | 3300042635 | Unclassified | 2273 |
| 153 | Ga0466704_230499 | 3300042643 | Unclassified | 6470 |
| 154 | Ga0466709_075030 | 3300042648 | Bacteria | 18734 |
| 155 | Ga0466709_282553 | 3300042648 | Bacteria | 6053 |
| 156 | Ga0466708_217478 | 3300042652 | Bacteria | 4917 |
| 157 | Ga0466718_092344 | 3300042617 | Unclassified | 1720 |
| 158 | Ga0123356_10005080 | 3300010049 | Bacteria | 13494 |
| 159 | Ga0123356_10008189 | 3300010049 | Bacteria | 10402 |
| 160 | Ga0466722_057201 | 3300042609 | Bacteria | 3594 |
| 161 | JGI24698J34947_10003210 | 3300002449 | Bacteria | 8860 |
| 162 | Ga0466690_064259 | 3300042590 | Bacteria | 3241 |
| 163 | Ga0466693_065679 | 3300042592 | Bacteria | 21484 |
| 164 | Ga0466691_163595 | 3300042593 | Bacteria | 3641 |
| 165 | Ga0466694_081597 | 3300042594 | Bacteria | 19836 |
| 166 | Ga0466694_251773 | 3300042594 | Bacteria | 56431 |
| 167 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
| 168 | Ga0466699_113525 | 3300042597 | Bacteria | 1881 |
| 169 | Ga0466731_136713 | 3300042622 | Bacteria | 1654 |
| 170 | Ga0466731_303313 | 3300042622 | Bacteria | 6905 |
| 171 | Ga0466709_038128 | 3300042648 | Bacteria | 4133 |
| 172 | Ga0466708_216297 | 3300042652 | Bacteria | 1869 |
| 173 | Ga0466715_226343 | 3300042616 | Bacteria | 1986 |
| 174 | Ga0466726_426089 | 3300042619 | Bacteria | 1727 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005201 | Ga0072941_1038643 | Ga0072941_10386433 | 331 |
| 2 | 3300005201 | Ga0072941_1052828 | Ga0072941_10528286 | 389 |
| 3 | 3300042635 | Ga0466702_244839 | Ga0466702_244839_30_1382 | 389 |
| 4 | 3300024493 | Ga0264413_105376 | Ga0264413_1053762 | 395 |
| 5 | 3300042617 | Ga0466718_092344 | Ga0466718_092344_446_1687 | 401 |
| 6 | 3300042622 | Ga0466731_136713 | Ga0466731_136713_24_1232 | 402 |
| 7 | 3300038395 | Ga0415639_004195 | Ga0415639_004195_7360_8574 | 404 |
| 8 | 3300005201 | Ga0072941_1027704 | Ga0072941_10277044 | 406 |
| 9 | 3300010049 | Ga0123356_10005342 | Ga0123356_1000534210 | 408 |
| 10 | iso_pr_bacteria | 2781125657 | 2781324358 | 410 |
| 11 | 3300042635 | Ga0466702_096707 | Ga0466702_096707_6519_7853 | 415 |
| 12 | 3300042614 | Ga0466712_110696 | Ga0466712_110696_1883_3226 | 418 |
| 13 | 3300002449 | JGI24698J34947_10012004 | JGI24698J34947_100120042 | 419 |
| 14 | 3300002449 | JGI24698J34947_10013062 | JGI24698J34947_100130623 | 420 |
| 15 | 3300042594 | Ga0466694_251773 | Ga0466694_251773_13374_14720 | 420 |
| 16 | 3300042614 | Ga0466712_303680 | Ga0466712_303680_2213_3556 | 422 |
| 17 | 3300002449 | JGI24698J34947_10003210 | JGI24698J34947_100032103 | 423 |
| 18 | 3300005201 | Ga0072941_1006176 | Ga0072941_100617610 | 424 |
| 19 | 3300005201 | Ga0072941_1028792 | Ga0072941_10287927 | 425 |
| 20 | 3300010049 | Ga0123356_10189010 | Ga0123356_101890102 | 425 |
| 21 | 3300010049 | Ga0123356_10000381 | Ga0123356_1000038144 | 428 |
| 22 | 3300042622 | Ga0466731_303313 | Ga0466731_303313_5017_6366 | 430 |
| 23 | 3300042592 | Ga0466693_065679 | Ga0466693_065679_2894_4267 | 431 |
| 24 | 3300010049 | Ga0123356_10005080 | Ga0123356_100050809 | 432 |
| 25 | 3300002450 | JGI24695J34938_10032795 | JGI24695J34938_100327952 | 433 |
| 26 | 3300002450 | JGI24695J34938_10030505 | JGI24695J34938_100305052 | 435 |
| 27 | 3300042614 | Ga0466712_237055 | Ga0466712_237055_4042_5394 | 435 |
| 28 | 3300002449 | JGI24698J34947_10003806 | JGI24698J34947_100038064 | 436 |
| 29 | 3300042614 | Ga0466712_022351 | Ga0466712_022351_5550_6926 | 436 |
| 30 | 3300042614 | Ga0466712_048199 | Ga0466712_048199_6142_7497 | 436 |
| 31 | 3300010049 | Ga0123356_10004948 | Ga0123356_100049485 | 437 |
| 32 | 3300042635 | Ga0466702_017222 | Ga0466702_017222_318_1676 | 438 |
| 33 | 3300002450 | JGI24695J34938_10025457 | JGI24695J34938_100254573 | 439 |
| 34 | 3300002450 | JGI24695J34938_10003435 | JGI24695J34938_100034355 | 440 |
| 35 | 3300042617 | Ga0466718_012362 | Ga0466718_012362_4343_5704 | 440 |
| 36 | 3300024493 | Ga0264413_105377 | Ga0264413_10537713 | 441 |
| 37 | 3300005201 | Ga0072941_1008455 | Ga0072941_10084554 | 442 |
| 38 | 3300005201 | Ga0072941_1009157 | Ga0072941_10091573 | 442 |
| 39 | 3300024493 | Ga0264413_105378 | Ga0264413_1053782 | 442 |
| 40 | 3300010049 | Ga0123356_10006830 | Ga0123356_1000683011 | 444 |
| 41 | 3300042614 | Ga0466712_275466 | Ga0466712_275466_1997_3331 | 444 |
| 42 | 3300042617 | Ga0466718_081719 | Ga0466718_081719_1327_2697 | 444 |
| 43 | 3300002449 | JGI24698J34947_10001581 | JGI24698J34947_100015813 | 445 |
| 44 | 3300010049 | Ga0123356_10008189 | Ga0123356_100081898 | 446 |
| 45 | 3300042591 | Ga0466692_147413 | Ga0466692_147413_14761_16101 | 446 |
| 46 | 3300042591 | Ga0466692_191519 | Ga0466692_191519_434_1774 | 446 |
| 47 | 3300042601 | Ga0466707_209513 | Ga0466707_209513_1191_2531 | 446 |
| 48 | 3300042606 | Ga0466719_256363 | Ga0466719_256363_4447_5787 | 446 |
| 49 | 3300042616 | Ga0466715_226343 | Ga0466715_226343_497_1837 | 446 |
| 50 | 3300042617 | Ga0466718_130959 | Ga0466718_130959_1731_3107 | 446 |
| 51 | 3300042643 | Ga0466704_168570 | Ga0466704_168570_2883_4238 | 446 |
| 52 | 3300042656 | Ga0466732_049350 | Ga0466732_049350_13339_14679 | 446 |
| 53 | iso_pr_bacteria | 2781125664 | 2781339844 | 446 |
| 54 | iso_pr_bacteria | 2781125666 | 2781345535 | 446 |
| 55 | 3300009784 | Ga0123357_10004871 | Ga0123357_1000487114 | 447 |
| 56 | 3300010049 | Ga0123356_10183389 | Ga0123356_101833892 | 447 |
| 57 | 3300038395 | Ga0415639_055315 | Ga0415639_055315_777_2171 | 447 |
| 58 | 3300042601 | Ga0466707_085867 | Ga0466707_085867_1099_2442 | 447 |
| 59 | 3300042602 | Ga0466713_024032 | Ga0466713_024032_8340_9683 | 447 |
| 60 | 3300042614 | Ga0466712_110435 | Ga0466712_110435_1608_2951 | 447 |
| 61 | 3300042616 | Ga0466715_052824 | Ga0466715_052824_934_2277 | 447 |
| 62 | 3300042617 | Ga0466718_021161 | Ga0466718_021161_462_1805 | 447 |
| 63 | 3300042617 | Ga0466718_115643 | Ga0466718_115643_681_2024 | 447 |
| 64 | iso_pr_bacteria | 2781125650 | 2781308419 | 447 |
| 65 | 3300002449 | JGI24698J34947_10014215 | JGI24698J34947_100142152 | 448 |
| 66 | 3300002450 | JGI24695J34938_10000409 | JGI24695J34938_1000040917 | 448 |
| 67 | 3300002450 | JGI24695J34938_10000777 | JGI24695J34938_100007776 | 448 |
| 68 | 3300005201 | Ga0072941_1006174 | Ga0072941_10061745 | 448 |
| 69 | 3300005201 | Ga0072941_1010098 | Ga0072941_10100988 | 448 |
| 70 | 3300009784 | Ga0123357_10009188 | Ga0123357_1000918812 | 448 |
| 71 | 3300009826 | Ga0123355_10153952 | Ga0123355_101539524 | 448 |
| 72 | 3300010049 | Ga0123356_10001153 | Ga0123356_1000115316 | 448 |
| 73 | 3300042614 | Ga0466712_075344 | Ga0466712_075344_2913_4259 | 448 |
| 74 | 3300042614 | Ga0466712_267773 | Ga0466712_267773_12850_14196 | 448 |
| 75 | iso_pr_bacteria | 2781125665 | 2781341448 | 448 |
| 76 | 3300005201 | Ga0072941_1001715 | Ga0072941_100171510 | 449 |
| 77 | 3300010049 | Ga0123356_10000309 | Ga0123356_1000030929 | 449 |
| 78 | 3300010049 | Ga0123356_10017436 | Ga0123356_100174362 | 449 |
| 79 | 3300024493 | Ga0264413_102688 | Ga0264413_1026886 | 449 |
| 80 | 3300024493 | Ga0264413_114332 | Ga0264413_1143322 | 449 |
| 81 | 3300042594 | Ga0466694_081597 | Ga0466694_081597_18353_19702 | 449 |
| 82 | 3300042608 | Ga0466721_209094 | Ga0466721_209094_13836_15185 | 449 |
| 83 | 3300042609 | Ga0466722_254680 | Ga0466722_254680_231_1580 | 449 |
| 84 | 3300042614 | Ga0466712_081472 | Ga0466712_081472_4451_5800 | 449 |
| 85 | 3300042616 | Ga0466715_643038 | Ga0466715_643038_1955_3418 | 449 |
| 86 | 3300042619 | Ga0466726_426089 | Ga0466726_426089_142_1512 | 449 |
| 87 | iso_pr_bacteria | 2781125634 | 2781275560 | 449 |
| 88 | iso_pr_bacteria | 2781125637 | 2781282963 | 449 |
| 89 | iso_pr_bacteria | 2781125649 | 2781307849 | 449 |
| 90 | iso_pr_bacteria | 2781125661 | 2781332771 | 449 |
| 91 | 3300000089 | AustNasuHG_c1000283 | AustNasuHG_100028322 | 450 |
| 92 | 3300002449 | JGI24698J34947_10002680 | JGI24698J34947_100026808 | 450 |
| 93 | 3300002449 | JGI24698J34947_10002803 | JGI24698J34947_100028033 | 450 |
| 94 | 3300002449 | JGI24698J34947_10017287 | JGI24698J34947_100172873 | 450 |
| 95 | 3300002450 | JGI24695J34938_10000193 | JGI24695J34938_1000019327 | 450 |
| 96 | 3300005200 | Ga0072940_1011464 | Ga0072940_10114649 | 450 |
| 97 | 3300042596 | Ga0466696_232758 | Ga0466696_232758_4395_5747 | 450 |
| 98 | 3300042597 | Ga0466699_113525 | Ga0466699_113525_123_1475 | 450 |
| 99 | 3300042597 | Ga0466699_184779 | Ga0466699_184779_117_1469 | 450 |
| 100 | 3300042609 | Ga0466722_046420 | Ga0466722_046420_1009_2427 | 450 |
| 101 | 3300042610 | Ga0466698_195093 | Ga0466698_195093_1895_3247 | 450 |
| 102 | 3300042621 | Ga0466729_268891 | Ga0466729_268891_494_1846 | 450 |
| 103 | 3300042643 | Ga0466704_106254 | Ga0466704_106254_11921_13357 | 450 |
| 104 | iso_pr_bacteria | 2781125652 | 2781311526 | 450 |
| 105 | 3300010049 | Ga0123356_10283240 | Ga0123356_102832402 | 451 |
| 106 | 3300010049 | Ga0123356_10325861 | Ga0123356_103258612 | 451 |
| 107 | 3300042592 | Ga0466693_236340 | Ga0466693_236340_3302_4657 | 451 |
| 108 | 3300042596 | Ga0466696_019433 | Ga0466696_019433_3666_5021 | 451 |
| 109 | 3300042597 | Ga0466699_038021 | Ga0466699_038021_52_1407 | 451 |
| 110 | 3300042597 | Ga0466699_041352 | Ga0466699_041352_44_1399 | 451 |
| 111 | 3300042597 | Ga0466699_316695 | Ga0466699_316695_6412_7767 | 451 |
| 112 | 3300042609 | Ga0466722_039060 | Ga0466722_039060_922_2277 | 451 |
| 113 | 3300042609 | Ga0466722_108788 | Ga0466722_108788_11824_13179 | 451 |
| 114 | iso_pr_bacteria | 2781125648 | 2781305796 | 451 |
| 115 | 3300002450 | JGI24695J34938_10004008 | JGI24695J34938_100040083 | 452 |
| 116 | 3300002450 | JGI24695J34938_10009000 | JGI24695J34938_100090004 | 452 |
| 117 | 3300010049 | Ga0123356_10046807 | Ga0123356_100468073 | 452 |
| 118 | 3300042594 | Ga0466694_087301 | Ga0466694_087301_31092_32450 | 452 |
| 119 | 3300042607 | Ga0466720_055247 | Ga0466720_055247_6264_7622 | 452 |
| 120 | 3300042607 | Ga0466720_094550 | Ga0466720_094550_5573_6931 | 452 |
| 121 | 3300042615 | Ga0466711_313458 | Ga0466711_313458_2086_3444 | 452 |
| 122 | 3300042643 | Ga0466704_075394 | Ga0466704_075394_497_1915 | 452 |
| 123 | iso_pr_bacteria | 2781125635 | 2781276884 | 452 |
| 124 | iso_pr_bacteria | 2781125645 | 2781298408 | 452 |
| 125 | 3300002450 | JGI24695J34938_10007211 | JGI24695J34938_100072113 | 453 |
| 126 | 3300042593 | Ga0466691_105208 | Ga0466691_105208_883_2262 | 453 |
| 127 | 3300042596 | Ga0466696_239440 | Ga0466696_239440_1661_3022 | 453 |
| 128 | 3300042605 | Ga0466716_514934 | Ga0466716_514934_9306_10688 | 453 |
| 129 | 3300042615 | Ga0466711_170323 | Ga0466711_170323_21732_23093 | 453 |
| 130 | 3300042636 | Ga0466703_151881 | Ga0466703_151881_12829_14190 | 453 |
| 131 | 3300042652 | Ga0466708_192647 | Ga0466708_192647_5849_7231 | 453 |
| 132 | 3300010049 | Ga0123356_10004991 | Ga0123356_1000499111 | 454 |
| 133 | 3300010167 | Ga0123353_10024058 | Ga0123353_100240586 | 454 |
| 134 | 3300042594 | Ga0466694_043546 | Ga0466694_043546_8873_10237 | 454 |
| 135 | 3300042605 | Ga0466716_421837 | Ga0466716_421837_7624_8988 | 454 |
| 136 | 3300042609 | Ga0466722_206051 | Ga0466722_206051_4023_5387 | 454 |
| 137 | 3300042612 | Ga0466705_335442 | Ga0466705_335442_2031_3395 | 454 |
| 138 | 3300042620 | Ga0466728_143566 | Ga0466728_143566_5592_6956 | 454 |
| 139 | 3300042643 | Ga0466704_230499 | Ga0466704_230499_1396_2760 | 454 |
| 140 | 3300042648 | Ga0466709_282553 | Ga0466709_282553_3117_4481 | 454 |
| 141 | 3300024493 | Ga0264413_105374 | Ga0264413_1053746 | 455 |
| 142 | 3300042594 | Ga0466694_039131 | Ga0466694_039131_8398_9765 | 455 |
| 143 | 3300042594 | Ga0466694_095867 | Ga0466694_095867_797_2164 | 455 |
| 144 | 3300042648 | Ga0466709_038128 | Ga0466709_038128_1691_3091 | 455 |
| 145 | 3300042655 | Ga0466727_325218 | Ga0466727_325218_3727_5094 | 455 |
| 146 | 3300002450 | JGI24695J34938_10014435 | JGI24695J34938_100144354 | 456 |
| 147 | 3300002462 | JGI24702J35022_10001216 | JGI24702J35022_100012166 | 456 |
| 148 | 3300042593 | Ga0466691_163595 | Ga0466691_163595_2202_3572 | 456 |
| 149 | 3300042636 | Ga0466703_357727 | Ga0466703_357727_6497_7867 | 456 |
| 150 | 3300002450 | JGI24695J34938_10012307 | JGI24695J34938_100123073 | 457 |
| 151 | 3300042601 | Ga0466707_113977 | Ga0466707_113977_365_1738 | 457 |
| 152 | 3300042636 | Ga0466703_300871 | Ga0466703_300871_9004_10377 | 457 |
| 153 | 3300000089 | AustNasuHG_c1027116 | AustNasuHG_10271162 | 458 |
| 154 | 3300000089 | AustNasuHG_c1029534 | AustNasuHG_10295342 | 458 |
| 155 | 3300042594 | Ga0466694_185074 | Ga0466694_185074_3858_5234 | 458 |
| 156 | 3300042595 | Ga0466695_068957 | Ga0466695_068957_59034_60410 | 458 |
| 157 | 3300042605 | Ga0466716_393604 | Ga0466716_393604_275_1702 | 458 |
| 158 | 3300042620 | Ga0466728_045124 | Ga0466728_045124_1925_3301 | 458 |
| 159 | iso_pr_bacteria | 2781125662 | 2781337019 | 459 |
| 160 | 3300042590 | Ga0466690_196141 | Ga0466690_196141_340_1722 | 460 |
| 161 | 3300042593 | Ga0466691_011938 | Ga0466691_011938_2949_4331 | 460 |
| 162 | 3300042643 | Ga0466704_030655 | Ga0466704_030655_1916_3298 | 460 |
| 163 | 3300042652 | Ga0466708_009773 | Ga0466708_009773_218_1600 | 460 |
| 164 | 3300042590 | Ga0466690_253130 | Ga0466690_253130_177_1562 | 461 |
| 165 | iso_pr_bacteria | 2781125651 | 2781310085 | 461 |
| 166 | 3300042591 | Ga0466692_009167 | Ga0466692_009167_415_1803 | 462 |
| 167 | 3300042609 | Ga0466722_057201 | Ga0466722_057201_1933_3321 | 462 |
| 168 | iso_pr_bacteria | 2781125660 | 2781329724 | 462 |
| 169 | 3300002450 | JGI24695J34938_10002913 | JGI24695J34938_1000291311 | 463 |
| 170 | 3300010049 | Ga0123356_10000020 | Ga0123356_1000002028 | 463 |
| 171 | 3300042636 | Ga0466703_089491 | Ga0466703_089491_8606_9997 | 463 |
| 172 | 3300042596 | Ga0466696_082732 | Ga0466696_082732_24113_25507 | 464 |
| 173 | 3300042636 | Ga0466703_036743 | Ga0466703_036743_806_2200 | 464 |
| 174 | 3300042636 | Ga0466703_332679 | Ga0466703_332679_727_2121 | 464 |
| 175 | 3300042605 | Ga0466716_108798 | Ga0466716_108798_1347_2744 | 465 |
| 176 | 3300042612 | Ga0466705_046514 | Ga0466705_046514_1519_2991 | 465 |
| 177 | 3300042652 | Ga0466708_217478 | Ga0466708_217478_1714_3117 | 467 |
| 178 | 3300042652 | Ga0466708_290187 | Ga0466708_290187_1017_2441 | 468 |
| 179 | 3300042615 | Ga0466711_425921 | Ga0466711_425921_2012_3421 | 469 |
| 180 | 3300042648 | Ga0466709_156194 | Ga0466709_156194_921_2330 | 469 |
| 181 | 3300042636 | Ga0466703_109417 | Ga0466703_109417_2865_4280 | 471 |
| 182 | 3300042648 | Ga0466709_075030 | Ga0466709_075030_3516_4931 | 471 |
| 183 | 3300010167 | Ga0123353_10265860 | Ga0123353_102658602 | 472 |
| 184 | 3300042616 | Ga0466715_158411 | Ga0466715_158411_2846_4270 | 474 |
| 185 | 3300042616 | Ga0466715_260123 | Ga0466715_260123_1765_3189 | 474 |
| 186 | 3300042652 | Ga0466708_191293 | Ga0466708_191293_46_1476 | 476 |
| 187 | 3300042652 | Ga0466708_216297 | Ga0466708_216297_46_1476 | 476 |
| 188 | 3300042614 | Ga0466712_043338 | Ga0466712_043338_2852_4288 | 478 |
| 189 | 3300002450 | JGI24695J34938_10029987 | JGI24695J34938_100299872 | 483 |
| 190 | 3300042590 | Ga0466690_064259 | Ga0466690_064259_688_2361 | 557 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.