Protein Family IF00683

Metagenome Isolate
122 Members
46 Samples
112 Scaffolds
263.08 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10024474|JGI24695J34938_100244742
Length
299 aa
Sequence
MSVLKKPYLPICNIFNIIQKGEDMNCDPANPKGSGIVNVWQESVPVRFGSIDTSDKLTLDAIFQFFQEAAICHAENLGVGREAMAQTGQAWILSRMTVLVDRRPEYFETVSVRSWPRGFEKLFAIRDYCIKDKDDRAAVSARSAWLIVDMEKRRPLRPQAVMEKLPLNEELNAVTPEIAAITGLAERDNLQKVSERKALYTDLDYNGHVNNARYINWIEDALDPQILTKAEKMRIDINYLNEVRPGETVELLFAAIQPDENHDCLKNCGKKCQPFAFEGRKTESGQTAFRAELRLWEL*

📊 Sample Types

Isolate 8.2%
Metagenome 91.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 31.1%
Unclassified 22.2%
Rhinotermitidae 4.4%
Termopsidae 4.4%
Blaberidae 2.2%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
9 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
22 2772190975 Treponema sp. RmG30 Isolate Blaberidae
23 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
28 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
40 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_017351 3300038395 Bacteria 6845
2 Ga0466690_339246 3300042590 Bacteria 6663
3 Ga0466702_023571 3300042635 Bacteria 4233
4 Ga0466702_028830 3300042635 Bacteria 11470
5 Ga0466704_383244 3300042643 Bacteria 2715
6 Ga0466709_173765 3300042648 Bacteria 10033
7 Ga0123356_10002137 3300010049 Bacteria 21316
8 Ga0123356_10006129 3300010049 Unclassified 12202
9 Ga0123356_10021085 3300010049 Bacteria 6161
10 Ga0123356_10024113 3300010049 Bacteria 5726
11 Ga0123356_10034226 3300010049 Bacteria 4749
12 Ga0123356_10042834 3300010049 Bacteria 4216
13 Ga0123356_10047554 3300010049 Bacteria 3992
14 Ga0123356_11117988 3300010049 Bacteria 956
15 Ga0466706_262046 3300042599 Bacteria 1297
16 Ga0466722_228368 3300042609 Bacteria 8229
17 Ga0466718_008050 3300042617 Bacteria 9988
18 Ga0466726_131817 3300042619 Unclassified 1206
19 Ga0264413_111735 3300024493 Bacteria 3444
20 Ga0415639_057451 3300038395 Bacteria 14740
21 Ga0466690_277080 3300042590 Bacteria 2998
22 Ga0466691_119646 3300042593 Bacteria 7318
23 Ga0466694_263182 3300042594 Bacteria 1666
24 JGI24695J34938_10000613 3300002450 Bacteria 34131
25 JGI24695J34938_10024474 3300002450 Bacteria 2900
26 Ga0466705_287452 3300042612 Bacteria 5481
27 Ga0123356_10000299 3300010049 Bacteria 57073
28 Ga0123356_10003181 3300010049 Bacteria 17262
29 Ga0123356_10006588 3300010049 Bacteria 11702
30 Ga0123356_10020912 3300010049 Unclassified 6190
31 Ga0466713_155631 3300042602 Bacteria 1484
32 Ga0466716_263387 3300042605 Bacteria 10644
33 Ga0466711_376714 3300042615 Bacteria 40639
34 Ga0466723_203434 3300042618 Bacteria 29973
35 Ga0466726_208327 3300042619 Bacteria 3340
36 Ga0466693_404000 3300042592 Bacteria 6181
37 Ga0466691_066741 3300042593 Bacteria 12886
38 Ga0466699_065431 3300042597 Bacteria 25231
39 2230930164 2228664001 Bacteria 2493
40 AustNasuHG_c1027633 3300000089 Unclassified 1723
41 JGI24695J34938_10000054 3300002450 Bacteria 90526
42 JGI24695J34938_10000160 3300002450 Bacteria 62419
43 JGI24695J34938_10021956 3300002450 Bacteria 3110
44 Ga0072940_1255043 3300005200 Bacteria 1328
45 Ga0466703_336255 3300042636 Bacteria 8213
46 Ga0466727_029087 3300042655 Bacteria 2455
47 Ga0466727_075241 3300042655 Unclassified 4251
48 Ga0123356_10000222 3300010049 Bacteria 65834
49 Ga0123356_10002375 3300010049 Bacteria 20168
50 Ga0123353_10005537 3300010167 Bacteria 16599
51 Ga0466714_027430 3300042603 Bacteria 1317
52 Ga0466720_117229 3300042607 Bacteria 7816
53 Ga0466720_185484 3300042607 Bacteria 3913
54 Ga0466726_460488 3300042619 Bacteria 1962
55 Ga0466696_293189 3300042596 Bacteria 8461
56 JGI24695J34938_10000643 3300002450 Bacteria 33347
57 Ga0466705_110149 3300042612 Bacteria 1496
58 Ga0466703_008395 3300042636 Bacteria 10953
59 Ga0123356_10011992 3300010049 Bacteria 8434
60 Ga0123356_10157584 3300010049 Bacteria 2263
61 Ga0123356_10616122 3300010049 Bacteria 1251
62 Ga0466713_012717 3300042602 Bacteria 2775
63 Ga0466719_523680 3300042606 Bacteria 2679
64 Ga0466722_160013 3300042609 Bacteria 2421
65 Ga0466715_343881 3300042616 Bacteria 9300
66 Ga0466718_039927 3300042617 Bacteria 1607
67 Ga0264413_102275 3300024493 Unclassified 6804
68 Ga0264413_103523 3300024493 Bacteria 4948
69 Ga0415639_000099 3300038395 Unclassified 17829
70 Ga0466696_231724 3300042596 Bacteria 3558
71 AustNasuHG_c1030182 3300000089 Bacteria 1566
72 Ga0466702_281278 3300042635 Bacteria 2050
73 Ga0466702_455688 3300042635 Bacteria 1094
74 Ga0466703_092126 3300042636 Bacteria 2333
75 Ga0466704_155320 3300042643 Bacteria 5034
76 Ga0466708_149229 3300042652 Bacteria 2343
77 Ga0466727_279413 3300042655 Bacteria 1491
78 Ga0123356_10055021 3300010049 Bacteria 3706
79 Ga0466720_078611 3300042607 Unclassified 2286
80 Ga0466698_330455 3300042610 Bacteria 2351
81 Ga0466726_207410 3300042619 Unclassified 1022
82 Ga0466726_300329 3300042619 Bacteria 1497
83 Ga0466726_478409 3300042619 Unclassified 1499
84 Ga0466728_125472 3300042620 Bacteria 3862
85 Ga0466692_053252 3300042591 Bacteria 3060
86 Ga0466691_005363 3300042593 Bacteria 13047
87 Ga0466708_167550 3300042652 Unclassified 2282
88 Ga0123356_10078267 3300010049 Bacteria 3121
89 Ga0466718_097878 3300042617 Bacteria 1192
90 Ga0466690_301128 3300042590 Bacteria 14656
91 Ga0466694_209809 3300042594 Bacteria 2422
92 AustNasuHG_c1028982 3300000089 Bacteria 1637
93 JGI24695J34938_10000292 3300002450 Bacteria 49540
94 JGI24695J34938_10002466 3300002450 Bacteria 14120
95 Ga0068305_10532979 3300005083 Bacteria 14021
96 Ga0466719_044470 3300042606 Bacteria 5612
97 Ga0466723_066293 3300042618 Bacteria 13225
98 Ga0415639_010743 3300038395 Bacteria 14260
99 Ga0466692_153300 3300042591 Bacteria 2283
100 Ga0466694_202065 3300042594 Bacteria 1767
101 AustNasuHG_c1004275 3300000089 Bacteria 5124
102 AustNasuHG_c1026215 3300000089 Bacteria 1819
103 JGI24695J34938_10000033 3300002450 Bacteria 103928
104 JGI24695J34938_10000688 3300002450 Bacteria 31893
105 JGI24695J34938_10002005 3300002450 Bacteria 16160
106 Ga0466703_038284 3300042636 Bacteria 9637
107 Ga0466704_315847 3300042643 Bacteria 16521
108 Ga0466708_269328 3300042652 Unclassified 1567
109 Ga0123356_10164604 3300010049 Bacteria 2220
110 Ga0466720_037731 3300042607 Bacteria 7821
111 Ga0466711_441612 3300042615 Bacteria 22503
112 Ga0466726_489898 3300042619 Bacteria 2413

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_110149 Ga0466705_110149_627_1346 239
2 3300042596 Ga0466696_293189 Ga0466696_293189_3233_3955 240
3 3300042602 Ga0466713_012717 Ga0466713_012717_2019_2747 242
4 3300042619 Ga0466726_300329 Ga0466726_300329_705_1433 242
5 3300042590 Ga0466690_301128 Ga0466690_301128_9068_9802 244
6 3300042619 Ga0466726_208327 Ga0466726_208327_595_1329 244
7 3300042636 Ga0466703_092126 Ga0466703_092126_230_967 245
8 3300042593 Ga0466691_005363 Ga0466691_005363_8465_9208 247
9 3300042612 Ga0466705_287452 Ga0466705_287452_2973_3716 247
10 iso_pr_bacteria 2772190975 2773725027 247
11 3300042594 Ga0466694_202065 Ga0466694_202065_396_1211 248
12 3300042615 Ga0466711_376714 Ga0466711_376714_33485_34231 248
13 3300042619 Ga0466726_460488 Ga0466726_460488_573_1322 249
14 3300000089 AustNasuHG_c1028982 AustNasuHG_10289822 250
15 3300042596 Ga0466696_231724 Ga0466696_231724_1884_2642 252
16 3300042606 Ga0466719_523680 Ga0466719_523680_1230_1988 252
17 3300042636 Ga0466703_336255 Ga0466703_336255_7048_7806 252
18 3300042590 Ga0466690_277080 Ga0466690_277080_513_1274 253
19 3300042592 Ga0466693_404000 Ga0466693_404000_1381_2142 253
20 3300042599 Ga0466706_262046 Ga0466706_262046_50_814 254
21 3300042616 Ga0466715_343881 Ga0466715_343881_6856_7620 254
22 iso_pr_bacteria 2781125665 2781341360 254
23 3300010049 Ga0123356_10000299 Ga0123356_1000029969 255
24 3300042643 Ga0466704_315847 Ga0466704_315847_11505_12272 255
25 3300042643 Ga0466704_383244 Ga0466704_383244_457_1224 255
26 3300042643 Ga0466704_155320 Ga0466704_155320_2983_3753 256
27 3300002450 JGI24695J34938_10002005 JGI24695J34938_1000200514 257
28 3300042609 Ga0466722_160013 Ga0466722_160013_505_1278 257
29 3300042618 Ga0466723_066293 Ga0466723_066293_3028_3804 258
30 3300002450 JGI24695J34938_10000033 JGI24695J34938_100000333 259
31 3300010049 Ga0123356_10006129 Ga0123356_100061296 259
32 3300042617 Ga0466718_039927 Ga0466718_039927_85_903 259
33 3300042620 Ga0466728_125472 Ga0466728_125472_2865_3644 259
34 3300042655 Ga0466727_075241 Ga0466727_075241_605_1447 259
35 3300042655 Ga0466727_279413 Ga0466727_279413_157_936 259
36 iso_pr_bacteria 2781125648 2781304881 259
37 3300002450 JGI24695J34938_10000292 JGI24695J34938_1000029236 260
38 3300002450 JGI24695J34938_10002466 JGI24695J34938_100024666 260
39 3300042591 Ga0466692_053252 Ga0466692_053252_2047_2829 260
40 3300042635 Ga0466702_281278 Ga0466702_281278_198_980 260
41 iso_pr_bacteria 2781125664 2781339485 260
42 2228664001 2230930164 2230626427 261
43 3300010049 Ga0123356_10002375 Ga0123356_1000237522 261
44 3300024493 Ga0264413_102275 Ga0264413_1022755 261
45 3300024493 Ga0264413_103523 Ga0264413_1035234 261
46 3300024493 Ga0264413_111735 Ga0264413_1117353 261
47 3300042607 Ga0466720_037731 Ga0466720_037731_612_1397 261
48 3300042607 Ga0466720_078611 Ga0466720_078611_946_1731 261
49 3300042607 Ga0466720_185484 Ga0466720_185484_2989_3774 261
50 3300042609 Ga0466722_228368 Ga0466722_228368_2596_3381 261
51 3300042617 Ga0466718_097878 Ga0466718_097878_72_857 261
52 3300042635 Ga0466702_023571 Ga0466702_023571_582_1415 261
53 3300042635 Ga0466702_028830 Ga0466702_028830_6593_7378 261
54 3300010049 Ga0123356_10042834 Ga0123356_100428342 262
55 3300042594 Ga0466694_209809 Ga0466694_209809_50_838 262
56 3300042597 Ga0466699_065431 Ga0466699_065431_8292_9080 262
57 3300042605 Ga0466716_263387 Ga0466716_263387_6872_7660 262
58 3300042619 Ga0466726_489898 Ga0466726_489898_977_1765 262
59 3300038395 Ga0415639_000099 Ga0415639_000099_4800_5591 263
60 3300042594 Ga0466694_263182 Ga0466694_263182_372_1163 263
61 3300010049 Ga0123356_10055021 Ga0123356_100550212 264
62 3300010167 Ga0123353_10005537 Ga0123353_100055379 264
63 3300042615 Ga0466711_441612 Ga0466711_441612_1214_2008 264
64 3300042635 Ga0466702_455688 Ga0466702_455688_225_1019 264
65 3300010049 Ga0123356_10020912 Ga0123356_100209122 265
66 3300010049 Ga0123356_10047554 Ga0123356_100475543 265
67 3300010049 Ga0123356_10157584 Ga0123356_101575843 265
68 3300010049 Ga0123356_10164604 Ga0123356_101646043 265
69 3300042602 Ga0466713_155631 Ga0466713_155631_171_968 265
70 3300000089 AustNasuHG_c1026215 AustNasuHG_10262152 266
71 3300000089 AustNasuHG_c1027633 AustNasuHG_10276334 266
72 3300000089 AustNasuHG_c1030182 AustNasuHG_10301823 266
73 3300005083 Ga0068305_10532979 Ga0068305_1053297914 266
74 3300042648 Ga0466709_173765 Ga0466709_173765_8614_9414 266
75 3300042652 Ga0466708_149229 Ga0466708_149229_972_1817 266
76 3300042652 Ga0466708_269328 Ga0466708_269328_674_1474 266
77 3300042655 Ga0466727_029087 Ga0466727_029087_1314_2114 266
78 3300002450 JGI24695J34938_10000643 JGI24695J34938_100006436 267
79 3300042607 Ga0466720_117229 Ga0466720_117229_5988_6791 267
80 3300042618 Ga0466723_203434 Ga0466723_203434_19646_20449 267
81 3300042593 Ga0466691_066741 Ga0466691_066741_879_1685 268
82 iso_pr_bacteria 2781125635 2781277265 268
83 iso_pr_bacteria 2781125645 2781298333 268
84 3300002450 JGI24695J34938_10000160 JGI24695J34938_1000016013 269
85 3300042593 Ga0466691_119646 Ga0466691_119646_333_1142 269
86 3300042619 Ga0466726_131817 Ga0466726_131817_168_977 269
87 3300042636 Ga0466703_008395 Ga0466703_008395_5112_5921 269
88 3300042652 Ga0466708_167550 Ga0466708_167550_941_1750 269
89 3300038395 Ga0415639_010743 Ga0415639_010743_6832_7644 270
90 3300038395 Ga0415639_057451 Ga0415639_057451_13697_14509 270
91 3300042591 Ga0466692_153300 Ga0466692_153300_1393_2205 270
92 iso_pr_bacteria 2781125637 2781282139 270
93 iso_pr_bacteria 2781125649 2781306715 270
94 iso_pr_bacteria 2781125657 2781324306 270
95 iso_pr_bacteria 2781125665 2781341218 270
96 3300000089 AustNasuHG_c1004275 AustNasuHG_10042756 271
97 3300002450 JGI24695J34938_10000054 JGI24695J34938_1000005471 271
98 3300002450 JGI24695J34938_10000613 JGI24695J34938_1000061316 271
99 3300010049 Ga0123356_10000222 Ga0123356_1000022236 271
100 3300010049 Ga0123356_10002137 Ga0123356_100021375 271
101 3300010049 Ga0123356_10003181 Ga0123356_1000318117 271
102 3300010049 Ga0123356_10006588 Ga0123356_100065883 271
103 3300010049 Ga0123356_10021085 Ga0123356_100210854 271
104 3300010049 Ga0123356_10024113 Ga0123356_100241133 271
105 3300010049 Ga0123356_10034226 Ga0123356_100342262 271
106 3300010049 Ga0123356_10078267 Ga0123356_100782672 271
107 3300010049 Ga0123356_11117988 Ga0123356_111179881 271
108 3300038395 Ga0415639_017351 Ga0415639_017351_5498_6313 271
109 3300042603 Ga0466714_027430 Ga0466714_027430_310_1125 271
110 3300010049 Ga0123356_10011992 Ga0123356_1001199210 272
111 3300002450 JGI24695J34938_10000688 JGI24695J34938_1000068814 273
112 3300005200 Ga0072940_1255043 Ga0072940_12550432 273
113 3300042617 Ga0466718_008050 Ga0466718_008050_6625_7446 273
114 3300042619 Ga0466726_478409 Ga0466726_478409_512_1333 273
115 3300010049 Ga0123356_10616122 Ga0123356_106161221 275
116 3300042619 Ga0466726_207410 Ga0466726_207410_115_945 276
117 3300002450 JGI24695J34938_10021956 JGI24695J34938_100219562 277
118 3300042590 Ga0466690_339246 Ga0466690_339246_966_1802 278
119 3300042610 Ga0466698_330455 Ga0466698_330455_1166_2017 283
120 3300042606 Ga0466719_044470 Ga0466719_044470_3031_3888 285
121 3300042636 Ga0466703_038284 Ga0466703_038284_4140_5000 286
122 3300002450 JGI24695J34938_10024474 JGI24695J34938_100244742 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01643 Acyl-ACP_TE Acyl-ACP thioesterase N-terminal domain 38 157 0.97
PF20791 Acyl-ACP_TE_C Acyl-ACP thioesterase C-terminal domain 191 260 0.8
PF13279 4HBT_2 Thioesterase-like superfamily 201 226 0.7

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.