Protein Family IF00681
Metagenome
Isolate
120
Members
38
Samples
112
Scaffolds
289.28
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10023735|JGI24695J34938_100237352
- Length
- 320 aa
- Sequence
- MLNYNSASDLRAFLDREGLGMQKKFGQNFLINPQIRQALVEALDAKDGDEVWEIGPGLGAMTALLLEKGLKVKAFEIDLGFIRILKSMFLNSEKFELIEGDALKTWPSQDTAHFLLGNLPYNIAAALIADLIEKGRTFSRMVVTVQKEVALRMAASAGSPDYSSFSVVCASVYNVKTLMTIRPSSFFPQPNVDSMGVLLERREQACAENFAAKRGYPDCFYPLVRSLFESRRKTLKNNLLTFLSSRLGRINTRKGSDSSGDADRRIEGREKLKEICNAVLKENSLNGGERAEKLEFDAFLSIAKTIQNMPLLNSDVNCR*
Sample Types
Isolate
6.7%
Metagenome
93.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.1%
Unclassified
22.2%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Kalotermitidae
5.6%
Taxonomy
Archaea
0
Bacteria
110
Eukaryota
0
Viruses
1
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 6 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 19 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 20 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_103879 | 3300042659 | Bacteria | 22213 |
| 2 | Ga0466720_044575 | 3300042607 | Unclassified | 8488 |
| 3 | JGI24698J34947_10041270 | 3300002449 | Bacteria | 2377 |
| 4 | JGI24695J34938_10000568 | 3300002450 | Bacteria | 35544 |
| 5 | JGI24695J34938_10085241 | 3300002450 | Bacteria | 1301 |
| 6 | Ga0072941_1028098 | 3300005201 | Bacteria | 10487 |
| 7 | Ga0466712_259619 | 3300042614 | Bacteria | 4259 |
| 8 | Ga0466711_077645 | 3300042615 | Bacteria | 24912 |
| 9 | Ga0466718_047845 | 3300042617 | Bacteria | 2513 |
| 10 | Ga0466693_002405 | 3300042592 | Bacteria | 54310 |
| 11 | Ga0466699_218119 | 3300042597 | Bacteria | 9194 |
| 12 | Ga0466720_004303 | 3300042607 | Bacteria | 5202 |
| 13 | Ga0466720_112006 | 3300042607 | Bacteria | 11619 |
| 14 | Ga0466721_066164 | 3300042608 | Bacteria | 16548 |
| 15 | JGI24698J34947_10024741 | 3300002449 | Bacteria | 3203 |
| 16 | JGI24695J34938_10018390 | 3300002450 | Bacteria | 3496 |
| 17 | Ga0072940_1011847 | 3300005200 | Bacteria | 6605 |
| 18 | Ga0072940_1015170 | 3300005200 | Viruses | 3508 |
| 19 | Ga0072941_1039342 | 3300005201 | Bacteria | 6234 |
| 20 | Ga0072941_1064238 | 3300005201 | Unclassified | 5316 |
| 21 | Ga0466727_165610 | 3300042655 | Bacteria | 2003 |
| 22 | Ga0466727_341116 | 3300042655 | Bacteria | 1977 |
| 23 | Ga0466718_057860 | 3300042617 | Bacteria | 1272 |
| 24 | Ga0466718_100918 | 3300042617 | Bacteria | 2585 |
| 25 | Ga0123356_10105052 | 3300010049 | Unclassified | 2716 |
| 26 | Ga0264413_104053 | 3300024493 | Bacteria | 17683 |
| 27 | AustNasuHG_c1007529 | 3300000089 | Bacteria | 3869 |
| 28 | JGI24698J34947_10000007 | 3300002449 | Bacteria | 54610 |
| 29 | JGI24698J34947_10038655 | 3300002449 | Bacteria | 2474 |
| 30 | JGI24695J34938_10002563 | 3300002450 | Bacteria | 13699 |
| 31 | JGI24695J34938_10006132 | 3300002450 | Bacteria | 7315 |
| 32 | JGI24695J34938_10023735 | 3300002450 | Bacteria | 2953 |
| 33 | Ga0072940_1033740 | 3300005200 | Unclassified | 3415 |
| 34 | Ga0072941_1011779 | 3300005201 | Bacteria | 29388 |
| 35 | Ga0072941_1039341 | 3300005201 | Bacteria | 5000 |
| 36 | Ga0072941_1039343 | 3300005201 | Bacteria | 2083 |
| 37 | Ga0072941_1148402 | 3300005201 | Bacteria | 1769 |
| 38 | Ga0466702_174234 | 3300042635 | Bacteria | 1659 |
| 39 | Ga0466712_027725 | 3300042614 | Bacteria | 34997 |
| 40 | Ga0123355_10033636 | 3300009826 | Unclassified | 8326 |
| 41 | Ga0123356_10000788 | 3300010049 | Bacteria | 35154 |
| 42 | Ga0123353_10006753 | 3300010167 | Bacteria | 15373 |
| 43 | Ga0466692_151223 | 3300042591 | Unclassified | 6370 |
| 44 | Ga0466694_190357 | 3300042594 | Bacteria | 6672 |
| 45 | Ga0466720_068357 | 3300042607 | Bacteria | 11333 |
| 46 | AustNasuHG_c1003074 | 3300000089 | Bacteria | 6023 |
| 47 | AustNasuHG_c1005691 | 3300000089 | Bacteria | 4456 |
| 48 | JGI24695J34938_10001618 | 3300002450 | Bacteria | 18841 |
| 49 | JGI24695J34938_10007977 | 3300002450 | Bacteria | 6109 |
| 50 | Ga0072940_1010697 | 3300005200 | Bacteria | 3744 |
| 51 | Ga0466702_227304 | 3300042635 | Bacteria | 1934 |
| 52 | Ga0466703_355616 | 3300042636 | Bacteria | 14095 |
| 53 | Ga0466712_257317 | 3300042614 | Bacteria | 24558 |
| 54 | Ga0466726_154604 | 3300042619 | Bacteria | 2071 |
| 55 | Ga0123356_10006624 | 3300010049 | Bacteria | 11673 |
| 56 | Ga0415639_194886 | 3300038395 | Bacteria | 1044 |
| 57 | Ga0466699_036221 | 3300042597 | Bacteria | 24269 |
| 58 | Ga0466699_325728 | 3300042597 | Bacteria | 11474 |
| 59 | Ga0466732_069322 | 3300042656 | Bacteria | 4875 |
| 60 | AustNasuHG_c1031341 | 3300000089 | Bacteria | 1505 |
| 61 | JGI24698J34947_10041282 | 3300002449 | Bacteria | 2377 |
| 62 | JGI24695J34938_10003237 | 3300002450 | Bacteria | 11526 |
| 63 | Ga0072941_1039344 | 3300005201 | Bacteria | 6989 |
| 64 | Ga0072941_1039346 | 3300005201 | Bacteria | 5071 |
| 65 | Ga0466718_023623 | 3300042617 | Bacteria | 3086 |
| 66 | Ga0466718_087067 | 3300042617 | Bacteria | 1853 |
| 67 | Ga0123356_10004241 | 3300010049 | Bacteria | 14836 |
| 68 | Ga0123356_10126698 | 3300010049 | Bacteria | 2494 |
| 69 | Ga0123356_10538842 | 3300010049 | Bacteria | 1327 |
| 70 | Ga0264413_100418 | 3300024493 | Bacteria | 17878 |
| 71 | Ga0264413_112928 | 3300024493 | Bacteria | 7544 |
| 72 | Ga0415639_031736 | 3300038395 | Bacteria | 8247 |
| 73 | Ga0466695_181079 | 3300042595 | Bacteria | 41133 |
| 74 | Ga0466699_207373 | 3300042597 | Bacteria | 8131 |
| 75 | Ga0466732_091318 | 3300042656 | Bacteria | 8624 |
| 76 | JGI24698J34947_10001607 | 3300002449 | Bacteria | 12014 |
| 77 | JGI24698J34947_10062990 | 3300002449 | Unclassified | 1819 |
| 78 | JGI24695J34938_10004887 | 3300002450 | Bacteria | 8585 |
| 79 | JGI24699J35502_11059321 | 3300002509 | Bacteria | 1724 |
| 80 | Ga0072941_1011521 | 3300005201 | Bacteria | 14651 |
| 81 | Ga0466731_317461 | 3300042622 | Bacteria | 4069 |
| 82 | Ga0466712_096882 | 3300042614 | Bacteria | 42313 |
| 83 | Ga0466712_178804 | 3300042614 | Bacteria | 13952 |
| 84 | Ga0466718_030118 | 3300042617 | Bacteria | 5179 |
| 85 | Ga0466718_108588 | 3300042617 | Bacteria | 22533 |
| 86 | Ga0123356_10007118 | 3300010049 | Bacteria | 11207 |
| 87 | Ga0123356_10101457 | 3300010049 | Bacteria | 2761 |
| 88 | Ga0415639_022188 | 3300038395 | Bacteria | 15573 |
| 89 | Ga0415639_072901 | 3300038395 | Bacteria | 6473 |
| 90 | Ga0466699_103536 | 3300042597 | Bacteria | 10825 |
| 91 | Ga0466733_072759 | 3300042659 | Bacteria | 51080 |
| 92 | Ga0466712_039522 | 3300042614 | Bacteria | 3679 |
| 93 | Ga0466712_147933 | 3300042614 | Unclassified | 1935 |
| 94 | Ga0466712_178555 | 3300042614 | Bacteria | 2120 |
| 95 | Ga0466712_314425 | 3300042614 | Bacteria | 25648 |
| 96 | Ga0123356_10710073 | 3300010049 | Bacteria | 1175 |
| 97 | Ga0123353_10017028 | 3300010167 | Bacteria | 10656 |
| 98 | Ga0466694_072740 | 3300042594 | Bacteria | 1909 |
| 99 | Ga0466720_004667 | 3300042607 | Bacteria | 1734 |
| 100 | Ga0466720_193677 | 3300042607 | Bacteria | 15489 |
| 101 | Ga0466722_056894 | 3300042609 | Bacteria | 11763 |
| 102 | Ga0466698_234626 | 3300042610 | Bacteria | 14737 |
| 103 | AustNasuHG_c1000235 | 3300000089 | Bacteria | 18680 |
| 104 | AustNasuHG_c1015522 | 3300000089 | Bacteria | 2568 |
| 105 | JGI24698J34947_10042146 | 3300002449 | Bacteria | 2347 |
| 106 | JGI24695J34938_10002123 | 3300002450 | Bacteria | 15503 |
| 107 | Ga0466712_202426 | 3300042614 | Bacteria | 1118 |
| 108 | Ga0466712_228681 | 3300042614 | Bacteria | 33247 |
| 109 | Ga0466718_022853 | 3300042617 | Bacteria | 49734 |
| 110 | Ga0466718_087439 | 3300042617 | Unclassified | 1070 |
| 111 | Ga0123356_10016221 | 3300010049 | Bacteria | 7114 |
| 112 | Ga0264413_125962 | 3300024493 | Bacteria | 10124 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00398 | RrnaAD | Ribosomal RNA adenine dimethylase | 22 | 245 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.