Protein Family IF00680
Metagenome
Isolate
148
Members
43
Samples
140
Scaffolds
390.52
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10023409|JGI24695J34938_100234092
- Length
- 393 aa
- Sequence
- MAAPQPCFIHADIDAFYASVEQLDRPEYRGKPVIVGGLPGDRRSVVSAASYEARGFGVHSAMPLAQALKLCPDGIFLRGNMGRYRKKSAEIMAIFDEFSPSVRQLSIDEAFIDITGTGGLFGPPKEAAGKIKERVSREAGVTVSVGVSSNKYLAKIASGMSKPDGLYLIPAGGEEAFMRALPAEKIWGTGSATHELFRKHGIKTGDDIYRLSQGILASLFGKAKGLFLYRAVRGEGAAFEEERETRSISSERTFAFDLHDEFAMESVLFDLCQSLIWRLLEGKWRSRTVSVKIRYGDFSTEAARESRXEYVKTLNXLYDRLLGLFRRKYRKGRGLRLLGAGLMNLEDGTELQGELFGDDAEKDRRLEKAILDINKKFPDAALRRGRSWLAEQ*
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
26.2%
Unclassified
23.8%
Rhinotermitidae
7.1%
Termopsidae
7.1%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 20 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 42 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466696_062671 | 3300042596 | Bacteria | 7091 |
| 2 | Ga0466696_168948 | 3300042596 | Bacteria | 1637 |
| 3 | Ga0466699_234584 | 3300042597 | Bacteria | 5833 |
| 4 | Ga0466699_269090 | 3300042597 | Bacteria | 15052 |
| 5 | Ga0466699_332337 | 3300042597 | Bacteria | 18397 |
| 6 | Ga0466711_325246 | 3300042615 | Unclassified | 6997 |
| 7 | Ga0466715_111332 | 3300042616 | Bacteria | 4670 |
| 8 | Ga0466715_198886 | 3300042616 | Bacteria | 9412 |
| 9 | Ga0466723_066824 | 3300042618 | Bacteria | 21336 |
| 10 | Ga0466726_131517 | 3300042619 | Bacteria | 1524 |
| 11 | Ga0466704_355510 | 3300042643 | Bacteria | 5519 |
| 12 | Ga0466709_138202 | 3300042648 | Unclassified | 9282 |
| 13 | Ga0466708_127532 | 3300042652 | Bacteria | 8006 |
| 14 | Ga0466727_246530 | 3300042655 | Bacteria | 3687 |
| 15 | JGI24698J34947_10019600 | 3300002449 | Bacteria | 3646 |
| 16 | JGI24698J34947_10041856 | 3300002449 | Unclassified | 2357 |
| 17 | JGI24695J34938_10004264 | 3300002450 | Bacteria | 9472 |
| 18 | Ga0072941_1000038 | 3300005201 | Bacteria | 14911 |
| 19 | Ga0072941_1001002 | 3300005201 | Bacteria | 23705 |
| 20 | Ga0072941_1004513 | 3300005201 | Bacteria | 10301 |
| 21 | Ga0466707_014796 | 3300042601 | Bacteria | 2332 |
| 22 | Ga0466716_297730 | 3300042605 | Bacteria | 1318 |
| 23 | Ga0466722_077472 | 3300042609 | Bacteria | 5674 |
| 24 | Ga0466705_348785 | 3300042612 | Bacteria | 46858 |
| 25 | Ga0466696_030607 | 3300042596 | Bacteria | 3367 |
| 26 | Ga0466696_326426 | 3300042596 | Bacteria | 1966 |
| 27 | Ga0466699_442849 | 3300042597 | Bacteria | 14490 |
| 28 | Ga0466711_163489 | 3300042615 | Bacteria | 4033 |
| 29 | Ga0466711_306143 | 3300042615 | Bacteria | 4346 |
| 30 | Ga0466715_638349 | 3300042616 | Bacteria | 1894 |
| 31 | Ga0466723_064779 | 3300042618 | Bacteria | 8705 |
| 32 | Ga0466723_081246 | 3300042618 | Bacteria | 7643 |
| 33 | Ga0466728_255307 | 3300042620 | Bacteria | 4349 |
| 34 | Ga0123353_10166674 | 3300010167 | Bacteria | 3501 |
| 35 | Ga0123353_10439668 | 3300010167 | Bacteria | 1925 |
| 36 | Ga0466735_138359 | 3300042624 | Bacteria | 1960 |
| 37 | Ga0466704_153334 | 3300042643 | Bacteria | 11123 |
| 38 | Ga0466704_245155 | 3300042643 | Bacteria | 10978 |
| 39 | Ga0466709_226965 | 3300042648 | Bacteria | 29188 |
| 40 | Ga0466708_015433 | 3300042652 | Bacteria | 6109 |
| 41 | Ga0466708_412680 | 3300042652 | Bacteria | 4411 |
| 42 | Ga0466727_299510 | 3300042655 | Bacteria | 3602 |
| 43 | JGI24698J34947_10020972 | 3300002449 | Bacteria | 3518 |
| 44 | Ga0466706_079557 | 3300042599 | Bacteria | 1830 |
| 45 | Ga0466706_279736 | 3300042599 | Bacteria | 1589 |
| 46 | Ga0466713_097285 | 3300042602 | Bacteria | 16045 |
| 47 | Ga0466716_088306 | 3300042605 | Bacteria | 10529 |
| 48 | Ga0466716_273641 | 3300042605 | Bacteria | 14136 |
| 49 | Ga0466719_115079 | 3300042606 | Unclassified | 3048 |
| 50 | Ga0466698_322120 | 3300042610 | Bacteria | 1635 |
| 51 | Ga0466705_071228 | 3300042612 | Bacteria | 13707 |
| 52 | Ga0466705_192632 | 3300042612 | Bacteria | 3010 |
| 53 | Ga0466692_179170 | 3300042591 | Bacteria | 1614 |
| 54 | Ga0466691_027350 | 3300042593 | Bacteria | 4725 |
| 55 | Ga0466715_058920 | 3300042616 | Bacteria | 8916 |
| 56 | Ga0466715_217033 | 3300042616 | Bacteria | 3611 |
| 57 | Ga0466723_292948 | 3300042618 | Bacteria | 3022 |
| 58 | Ga0466723_372229 | 3300042618 | Bacteria | 25615 |
| 59 | Ga0466728_078365 | 3300042620 | Bacteria | 3714 |
| 60 | Ga0466735_067852 | 3300042624 | Bacteria | 4649 |
| 61 | Ga0466703_427429 | 3300042636 | Bacteria | 2660 |
| 62 | Ga0466708_369443 | 3300042652 | Bacteria | 17120 |
| 63 | JGI24702J35022_10008830 | 3300002462 | Bacteria | 5689 |
| 64 | Ga0466733_007578 | 3300042659 | Bacteria | 2305 |
| 65 | Ga0466690_045501 | 3300042590 | Bacteria | 20295 |
| 66 | Ga0466696_123277 | 3300042596 | Bacteria | 3065 |
| 67 | Ga0466699_073912 | 3300042597 | Bacteria | 1284 |
| 68 | Ga0466712_056081 | 3300042614 | Bacteria | 2672 |
| 69 | Ga0466712_074428 | 3300042614 | Bacteria | 10981 |
| 70 | Ga0466711_007779 | 3300042615 | Bacteria | 22172 |
| 71 | Ga0466711_038255 | 3300042615 | Bacteria | 11945 |
| 72 | Ga0466708_051008 | 3300042652 | Bacteria | 11008 |
| 73 | Ga0466727_244841 | 3300042655 | Bacteria | 2662 |
| 74 | Ga0466727_264712 | 3300042655 | Bacteria | 1716 |
| 75 | Ga0466716_359382 | 3300042605 | Bacteria | 1977 |
| 76 | Ga0466722_129785 | 3300042609 | Bacteria | 10733 |
| 77 | Ga0466705_322397 | 3300042612 | Bacteria | 1653 |
| 78 | Ga0466696_036964 | 3300042596 | Bacteria | 6133 |
| 79 | Ga0466696_126903 | 3300042596 | Bacteria | 19136 |
| 80 | Ga0466699_001476 | 3300042597 | Bacteria | 19710 |
| 81 | Ga0466699_077342 | 3300042597 | Bacteria | 9347 |
| 82 | Ga0466712_165976 | 3300042614 | Bacteria | 6828 |
| 83 | Ga0466711_007352 | 3300042615 | Bacteria | 10471 |
| 84 | Ga0123357_10156505 | 3300009784 | Bacteria | 2747 |
| 85 | Ga0123354_10157614 | 3300010882 | Bacteria | 2714 |
| 86 | Ga0466735_054816 | 3300042624 | Bacteria | 1603 |
| 87 | Ga0466704_184778 | 3300042643 | Bacteria | 18637 |
| 88 | Ga0466708_006474 | 3300042652 | Bacteria | 14186 |
| 89 | Ga0466719_188046 | 3300042606 | Bacteria | 38254 |
| 90 | Ga0466719_427105 | 3300042606 | Bacteria | 2716 |
| 91 | Ga0466691_094859 | 3300042593 | Bacteria | 1818 |
| 92 | Ga0466715_107156 | 3300042616 | Bacteria | 23208 |
| 93 | Ga0466715_194393 | 3300042616 | Bacteria | 13618 |
| 94 | Ga0466715_408473 | 3300042616 | Bacteria | 5939 |
| 95 | Ga0466729_001776 | 3300042621 | Unclassified | 1733 |
| 96 | Ga0466735_177155 | 3300042624 | Bacteria | 11713 |
| 97 | Ga0466735_190653 | 3300042624 | Bacteria | 14106 |
| 98 | Ga0466703_406661 | 3300042636 | Bacteria | 5679 |
| 99 | Ga0466703_419539 | 3300042636 | Bacteria | 6998 |
| 100 | Ga0466704_057294 | 3300042643 | Bacteria | 2894 |
| 101 | JGI24695J34938_10006515 | 3300002450 | Bacteria | 6985 |
| 102 | Ga0466707_071139 | 3300042601 | Bacteria | 1380 |
| 103 | Ga0466707_386951 | 3300042601 | Bacteria | 2469 |
| 104 | Ga0466713_049428 | 3300042602 | Bacteria | 7612 |
| 105 | Ga0466719_108800 | 3300042606 | Bacteria | 4559 |
| 106 | Ga0466722_100265 | 3300042609 | Bacteria | 3983 |
| 107 | Ga0466691_060576 | 3300042593 | Bacteria | 4098 |
| 108 | Ga0466699_294829 | 3300042597 | Bacteria | 18693 |
| 109 | Ga0466712_209494 | 3300042614 | Bacteria | 2019 |
| 110 | Ga0466715_126583 | 3300042616 | Bacteria | 15102 |
| 111 | Ga0466723_172604 | 3300042618 | Bacteria | 6876 |
| 112 | Ga0466728_001176 | 3300042620 | Bacteria | 2024 |
| 113 | Ga0466703_234743 | 3300042636 | Bacteria | 1790 |
| 114 | Ga0466703_378241 | 3300042636 | Bacteria | 14654 |
| 115 | Ga0466704_111099 | 3300042643 | Bacteria | 2628 |
| 116 | Ga0466704_461388 | 3300042643 | Bacteria | 6680 |
| 117 | Ga0466727_239321 | 3300042655 | Bacteria | 2941 |
| 118 | JGI24695J34938_10002080 | 3300002450 | Bacteria | 15709 |
| 119 | Ga0466716_510528 | 3300042605 | Bacteria | 2083 |
| 120 | Ga0466719_222490 | 3300042606 | Bacteria | 4211 |
| 121 | Ga0466722_230963 | 3300042609 | Bacteria | 1622 |
| 122 | Ga0466698_346284 | 3300042610 | Bacteria | 3188 |
| 123 | Ga0466705_036306 | 3300042612 | Bacteria | 2172 |
| 124 | Ga0466692_175784 | 3300042591 | Bacteria | 25241 |
| 125 | Ga0466694_072581 | 3300042594 | Bacteria | 5254 |
| 126 | Ga0466696_092521 | 3300042596 | Bacteria | 1628 |
| 127 | Ga0466699_051175 | 3300042597 | Bacteria | 3881 |
| 128 | Ga0466699_272280 | 3300042597 | Bacteria | 5548 |
| 129 | Ga0466715_432675 | 3300042616 | Bacteria | 9741 |
| 130 | Ga0466703_404866 | 3300042636 | Bacteria | 2481 |
| 131 | Ga0466704_499057 | 3300042643 | Bacteria | 60887 |
| 132 | Ga0466709_306938 | 3300042648 | Bacteria | 2857 |
| 133 | JGI24698J34947_10005707 | 3300002449 | Bacteria | 6826 |
| 134 | JGI24698J34947_10014185 | 3300002449 | Bacteria | 4338 |
| 135 | JGI24698J34947_10067001 | 3300002449 | Bacteria | 1744 |
| 136 | JGI24695J34938_10023409 | 3300002450 | Bacteria | 2979 |
| 137 | Ga0466707_049510 | 3300042601 | Bacteria | 2754 |
| 138 | Ga0466719_370207 | 3300042606 | Bacteria | 8784 |
| 139 | Ga0466719_386754 | 3300042606 | Bacteria | 3543 |
| 140 | Ga0466698_424751 | 3300042610 | Bacteria | 3575 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00817 | GO:0006281 | DNA repair | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.