Protein Family IF00643

Metagenome Isolate
111 Members
30 Samples
104 Scaffolds
418.4 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10008588|JGI24695J34938_100085884
Length
414 aa
Sequence
MELYIEKGENRMECELKIAQKYNRPFQILREKEISVGGFLGMFSKTGVQVEFIFSSPHYRNHNPYTQRTGMRSGYEPPHYDLEKDKLSSQSAIENGRETSREILNTLNELKEQIAGGKKEEHPALTRAAELLKLNDFSERYTNGMLEKLRKELSFEQLENPQTVQDHLLEWIGESISIYKETEKEKDASLSSPKIMVLVGPTGVGKTTTLSKLAAIYGIGTDENAAINVRMITIDAFRICAKEQLEQIGNIMQIPVRCVVNKQDLRKEIALHSEDTDMFLIDTIGKSPKDASKLGEMKEILDGAGRSAEFHLVISAGTKTSDIEVIMQQFEPFNYKSVILTKTDETDRIGNLISALSEKKKSVSYITNGQTVPVDIKRASVVNFLINMEGFKVNRERIEERFPSGEASQFKWR*

📊 Sample Types

Isolate 6.3%
Metagenome 93.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.3%
Unclassified 25.0%
Kalotermitidae 10.7%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
10 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
11 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
15 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
16 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
17 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
28 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1000900 3300000089 Bacteria 10727
2 JGI24698J34947_10001638 3300002449 Bacteria 11919
3 JGI24695J34938_10002800 3300002450 Bacteria 12763
4 JGI24697J35500_11269810 3300002507 Bacteria 4073
5 Ga0072941_1000577 3300005201 Bacteria 9125
6 Ga0072941_1022426 3300005201 Bacteria 10786
7 Ga0264413_105606 3300024493 Bacteria 14155
8 Ga0466694_009784 3300042594 Bacteria 17589
9 Ga0466699_086368 3300042597 Bacteria 3743
10 Ga0466712_076965 3300042614 Bacteria 15253
11 Ga0123356_10000569 3300010049 Bacteria 41050
12 Ga0123356_10003499 3300010049 Bacteria 16432
13 Ga0123356_10026347 3300010049 Bacteria 5460
14 Ga0123356_10144849 3300010049 Bacteria 2349
15 Ga0072941_1035663 3300005201 Bacteria 10977
16 Ga0072941_1283808 3300005201 Bacteria 3424
17 Ga0466699_086109 3300042597 Bacteria 13389
18 Ga0466712_126245 3300042614 Bacteria 32754
19 Ga0466712_160189 3300042614 Bacteria 14802
20 Ga0466712_314706 3300042614 Bacteria 5829
21 Ga0466720_096144 3300042607 Bacteria 5132
22 Ga0123356_10002802 3300010049 Bacteria 18471
23 Ga0123356_10164478 3300010049 Bacteria 2221
24 JGI24698J34947_10017097 3300002449 Bacteria 3934
25 JGI24698J34947_10017167 3300002449 Bacteria 3925
26 JGI24698J34947_10059695 3300002449 Bacteria 1884
27 JGI24695J34938_10002016 3300002450 Bacteria 16106
28 JGI24695J34938_10004893 3300002450 Bacteria 8580
29 Ga0072940_1280558 3300005200 Bacteria 4801
30 Ga0072941_1030103 3300005201 Bacteria 10804
31 Ga0072941_1057031 3300005201 Bacteria 3288
32 Ga0264413_118642 3300024493 Bacteria 3207
33 Ga0466693_102434 3300042592 Bacteria 17422
34 Ga0466694_015632 3300042594 Bacteria 3493
35 Ga0466712_124421 3300042614 Bacteria 30150
36 Ga0466712_277925 3300042614 Bacteria 3912
37 Ga0466718_021384 3300042617 Bacteria 3489
38 Ga0466718_134407 3300042617 Bacteria 16182
39 Ga0466732_240134 3300042656 Bacteria 3080
40 Ga0466720_014615 3300042607 Bacteria 4675
41 Ga0123356_10006771 3300010049 Bacteria 11532
42 JGI24698J34947_10025799 3300002449 Bacteria 3125
43 JGI24698J34947_10044368 3300002449 Bacteria 2276
44 JGI24695J34938_10000539 3300002450 Bacteria 36667
45 Ga0072941_1084484 3300005201 Bacteria 1760
46 Ga0072941_1094735 3300005201 Bacteria 2126
47 Ga0466731_144034 3300042622 Bacteria 4289
48 Ga0466731_387929 3300042622 Bacteria 4000
49 Ga0264413_100706 3300024493 Bacteria 38319
50 Ga0415639_043032 3300038395 Bacteria 2058
51 Ga0466699_108214 3300042597 Bacteria 10309
52 Ga0466712_091946 3300042614 Bacteria 86490
53 Ga0123356_10007581 3300010049 Bacteria 10821
54 JGI24698J34947_10000574 3300002449 Bacteria 17512
55 JGI24695J34938_10001991 3300002450 Bacteria 16278
56 JGI24695J34938_10002922 3300002450 Bacteria 12391
57 JGI24695J34938_10019703 3300002450 Bacteria 3335
58 Ga0466702_368953 3300042635 Bacteria 3828
59 Ga0466690_123082 3300042590 Bacteria 18470
60 Ga0466694_058999 3300042594 Unclassified 1508
61 Ga0466712_210203 3300042614 Bacteria 4891
62 Ga0123356_10001692 3300010049 Bacteria 24136
63 Ga0123356_10007572 3300010049 Bacteria 10830
64 Ga0123356_10073113 3300010049 Bacteria 3223
65 Ga0123356_10121968 3300010049 Bacteria 2537
66 JGI24695J34938_10008588 3300002450 Bacteria 5805
67 Ga0072941_1003821 3300005201 Bacteria 27657
68 Ga0072941_1030101 3300005201 Bacteria 12889
69 Ga0072941_1057032 3300005201 Bacteria 2293
70 Ga0072941_1136495 3300005201 Bacteria 2673
71 Ga0264413_105605 3300024493 Bacteria 26648
72 Ga0264413_108459 3300024493 Bacteria 5224
73 Ga0415639_007861 3300038395 Bacteria 10721
74 Ga0466694_119036 3300042594 Bacteria 1685
75 Ga0466694_144482 3300042594 Bacteria 2027
76 Ga0466712_033045 3300042614 Bacteria 12290
77 Ga0466712_264666 3300042614 Bacteria 18136
78 Ga0466723_002067 3300042618 Bacteria 17004
79 Ga0466732_169331 3300042656 Bacteria 16180
80 Ga0123356_10000882 3300010049 Bacteria 33318
81 Ga0123356_10066881 3300010049 Bacteria 3365
82 AustNasuHG_c1000148 3300000089 Bacteria 22158
83 Ga0072941_1000575 3300005201 Bacteria 2437
84 Ga0072941_1084485 3300005201 Bacteria 2018
85 Ga0072941_1098397 3300005201 Bacteria 1755
86 Ga0074263_117966 3300005485 Bacteria 4702
87 Ga0466702_191144 3300042635 Bacteria 6726
88 Ga0415639_091358 3300038395 Bacteria 5956
89 Ga0466712_069816 3300042614 Bacteria 15557
90 Ga0466715_227993 3300042616 Bacteria 17365
91 Ga0466698_101912 3300042610 Bacteria 23053
92 Ga0123356_10246504 3300010049 Bacteria 1861
93 JGI24698J34947_10014134 3300002449 Bacteria 4348
94 JGI24698J34947_10029828 3300002449 Bacteria 2879
95 JGI24695J34938_10000143 3300002450 Bacteria 65111
96 JGI24695J34938_10000689 3300002450 Bacteria 31877
97 JGI24695J34938_10001515 3300002450 Bacteria 19589
98 JGI24695J34938_10002588 3300002450 Bacteria 13637
99 Ga0072941_1057033 3300005201 Bacteria 2295
100 Ga0466702_400919 3300042635 Bacteria 2268
101 Ga0415639_035427 3300038395 Bacteria 5341
102 Ga0466699_144667 3300042597 Bacteria 16462
103 Ga0466699_424538 3300042597 Bacteria 15640
104 Ga0466718_019230 3300042617 Bacteria 13606

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00448 SRP54 SRP54-type protein, GTPase domain 193 384 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.