Protein Family IF00637

Metagenome Isolate
183 Members
53 Samples
169 Scaffolds
702.96 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10006770|JGI24695J34938_100067702
Length
762 aa
Sequence
MEAPCFVSDIYVPQMLYALTVRSPVAKGRLVSIECPELPEGCTLIKAGDIPGENSLWGSDLPILASGELSYIGEPVALLLGLKKDRLEKYALSCKVIAEEGRPVFSIGEATAIADTEPGLIAARRDIRVGEPEEAFASAASIVKGDYETGIQEHWYSEPCGAIAWLEGQGIRDEQEEEGQENGGASQEQAEGKGQKGQKLVIRTATQCPLHIRHSVARVLGSGHAAPAIQVQPTAAGLHLDGKFWYPSLVSCHAALGAWVTGKPVRLILNKKEDFFFSPKRFGARISVSSAFDEQGELIGTDVEASINLGAYGVSAAGAGDPSGAAEMLDQVCLGSLGIYASKNIRFRGMALRTNIPPQGPFAGLGLAQGSFALERHASLIADKRRQDPSEWRKARFLKTNSLPLGLPVKEAIPGERLLDSAMNMSDYRRKWASYELLRRKRHEQLSQDDSQQTTRVEIGESLRGIGIAIGYQGNKLLHPGPDGGGYGVELILEKDGSLEIKAEMAGSDQAAVWTGIALEILGVEAGNVRISCNDKTFQESGIPESGPAIMSHKATDLTRLVEEACLAIRGQRFRDPLPISVVKTGGPQEDPEWNKHFSLPGGAAPDCSGFLQPGSAAAVVEVEIDPVEYVPKIRGVWLAVDGGRVFRKDKASRSLRLSAVQALGWAYREQIGYAEGRIPVDAFRNFDIQGASEAPPVGISFIENSSDEPKGIGDLPFNCIPAAYLEAVSQAMDWHFRSIPLKARDLWHAAMTKAKKGEEG*

📊 Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.3%
Unclassified 29.4%
Kalotermitidae 27.5%
Rhinotermitidae 3.9%
Termopsidae 2.0%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 183
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
17 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
25 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
38 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
43 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2772190975 Treponema sp. RmG30 Isolate Blaberidae
50 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
53 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_120433 3300024493 Bacteria 11169
2 Ga0466692_190486 3300042591 Bacteria 17825
3 Ga0466693_124989 3300042592 Bacteria 4498
4 Ga0466694_403400 3300042594 Bacteria 17229
5 Ga0466699_019399 3300042597 Bacteria 7419
6 Ga0466699_024328 3300042597 Bacteria 3610
7 Ga0466699_094733 3300042597 Bacteria 4688
8 Ga0466704_036773 3300042643 Bacteria 9285
9 Ga0466704_150438 3300042643 Bacteria 3750
10 Ga0466712_209850 3300042614 Bacteria 3869
11 Ga0466715_489021 3300042616 Bacteria 34263
12 Ga0466715_564102 3300042616 Bacteria 6750
13 Ga0466718_027395 3300042617 Bacteria 20192
14 Ga0466723_217442 3300042618 Bacteria 22009
15 Ga0123356_10000577 3300010049 Bacteria 40782
16 AustNasuHG_c1007356 3300000089 Bacteria 3919
17 JGI24698J34947_10003690 3300002449 Bacteria 8328
18 JGI24698J34947_10031319 3300002449 Bacteria 2801
19 JGI24695J34938_10000329 3300002450 Bacteria 46693
20 JGI24695J34938_10002464 3300002450 Bacteria 14131
21 Ga0466700_434566 3300042600 Bacteria 4327
22 Ga0466720_018424 3300042607 Bacteria 27206
23 Ga0264413_101025 3300024493 Bacteria 6317
24 Ga0264413_117929 3300024493 Bacteria 7959
25 Ga0264413_119479 3300024493 Bacteria 4153
26 Ga0466693_292731 3300042592 Bacteria 11996
27 Ga0466691_031804 3300042593 Bacteria 7258
28 Ga0466699_122260 3300042597 Bacteria 12025
29 Ga0466709_315748 3300042648 Bacteria 19630
30 Ga0466712_038130 3300042614 Bacteria 20446
31 Ga0466715_157094 3300042616 Bacteria 4677
32 Ga0466718_147139 3300042617 Bacteria 7522
33 AustNasuHG_c1001258 3300000089 Bacteria 9132
34 JGI24698J34947_10002414 3300002449 Bacteria 10060
35 JGI24695J34938_10004644 3300002450 Bacteria 8920
36 Ga0072940_1009277 3300005200 Bacteria 7836
37 Ga0072940_1018448 3300005200 Bacteria 5994
38 Ga0072941_1003349 3300005201 Bacteria 40356
39 Ga0466720_053516 3300042607 Bacteria 5779
40 Ga0466720_123820 3300042607 Bacteria 3032
41 Ga0466732_444035 3300042656 Bacteria 4692
42 Ga0415639_048186 3300038395 Bacteria 3183
43 Ga0466692_013239 3300042591 Bacteria 7081
44 Ga0466692_163898 3300042591 Bacteria 25340
45 Ga0466693_215613 3300042592 Bacteria 17543
46 Ga0466691_147874 3300042593 Bacteria 26528
47 Ga0466696_198548 3300042596 Bacteria 20253
48 Ga0466699_092365 3300042597 Bacteria 5025
49 Ga0466703_066655 3300042636 Bacteria 3481
50 Ga0466704_286886 3300042643 Bacteria 7520
51 Ga0466712_307482 3300042614 Bacteria 2526
52 Ga0466715_464176 3300042616 Bacteria 6733
53 Ga0123356_10000443 3300010049 Bacteria 47239
54 JGI24698J34947_10000580 3300002449 Bacteria 17418
55 JGI24698J34947_10012793 3300002449 Bacteria 4592
56 JGI24698J34947_10013836 3300002449 Bacteria 4398
57 JGI24698J34947_10022674 3300002449 Bacteria 3364
58 JGI24695J34938_10000348 3300002450 Bacteria 45575
59 JGI24695J34938_10006770 3300002450 Bacteria 6813
60 Ga0466719_204086 3300042606 Bacteria 20417
61 Ga0466720_139259 3300042607 Bacteria 5318
62 Ga0466720_178452 3300042607 Bacteria 61615
63 Ga0466720_185753 3300042607 Bacteria 3800
64 Ga0466722_084381 3300042609 Bacteria 43243
65 Ga0264413_105545 3300024493 Bacteria 3973
66 Ga0264413_117170 3300024493 Bacteria 5358
67 Ga0415639_004309 3300038395 Bacteria 11639
68 Ga0466695_284277 3300042595 Bacteria 15337
69 Ga0466699_206662 3300042597 Bacteria 21346
70 Ga0466715_061652 3300042616 Bacteria 12808
71 Ga0466718_088224 3300042617 Bacteria 8537
72 Ga0466718_090789 3300042617 Bacteria 2858
73 Ga0466718_152189 3300042617 Bacteria 3827
74 Ga0466723_014267 3300042618 Bacteria 9006
75 Ga0466723_228239 3300042618 Bacteria 6224
76 JGI24695J34938_10000355 3300002450 Bacteria 45167
77 JGI24695J34938_10001120 3300002450 Bacteria 24156
78 JGI24695J34938_10001747 3300002450 Bacteria 17965
79 Ga0072941_1005601 3300005201 Bacteria 2879
80 Ga0072941_1068150 3300005201 Bacteria 7119
81 Ga0072941_1113944 3300005201 Bacteria 3221
82 Ga0466720_047144 3300042607 Bacteria 11062
83 Ga0466705_076390 3300042612 Bacteria 11586
84 Ga0466694_123440 3300042594 Bacteria 50310
85 Ga0466696_159501 3300042596 Bacteria 22033
86 Ga0466703_084812 3300042636 Bacteria 9101
87 Ga0466704_417993 3300042643 Bacteria 12215
88 Ga0466708_056098 3300042652 Bacteria 19422
89 Ga0466712_132560 3300042614 Bacteria 3901
90 Ga0466711_265200 3300042615 Bacteria 8648
91 Ga0466715_089298 3300042616 Bacteria 10214
92 Ga0466715_192820 3300042616 Bacteria 9663
93 Ga0466718_050521 3300042617 Bacteria 6649
94 Ga0466718_050834 3300042617 Bacteria 3164
95 Ga0466718_126108 3300042617 Bacteria 7548
96 Ga0466728_319709 3300042620 Bacteria 10177
97 Ga0123355_10085902 3300009826 Bacteria 5005
98 Ga0123356_10001789 3300010049 Bacteria 23449
99 Ga0123356_10003358 3300010049 Bacteria 16805
100 AustNasuHG_c1000686 3300000089 Bacteria 12040
101 JGI24698J34947_10001254 3300002449 Bacteria 13277
102 JGI24695J34938_10003492 3300002450 Bacteria 10925
103 JGI24702J35022_10012568 3300002462 Bacteria 4701
104 Ga0466720_005383 3300042607 Bacteria 9250
105 Ga0466720_022808 3300042607 Bacteria 44153
106 Ga0466720_056128 3300042607 Bacteria 15747
107 Ga0466720_119607 3300042607 Bacteria 8266
108 Ga0466705_095885 3300042612 Bacteria 9517
109 Ga0466732_079215 3300042656 Bacteria 16766
110 Ga0466732_174943 3300042656 Bacteria 4046
111 Ga0466732_402812 3300042656 Bacteria 2599
112 Ga0264413_102996 3300024493 Bacteria 22929
113 Ga0466694_372355 3300042594 Bacteria 26103
114 Ga0466699_025250 3300042597 Bacteria 7745
115 Ga0466699_112043 3300042597 Bacteria 4087
116 Ga0466699_157063 3300042597 Bacteria 6153
117 Ga0466703_273006 3300042636 Bacteria 7797
118 Ga0466718_089840 3300042617 Bacteria 13842
119 JGI24698J34947_10015982 3300002449 Bacteria 4081
120 JGI24695J34938_10000420 3300002450 Bacteria 41178
121 JGI24695J34938_10000511 3300002450 Bacteria 37801
122 Ga0072940_1007651 3300005200 Bacteria 5884
123 Ga0072941_1003381 3300005201 Bacteria 4443
124 Ga0072941_1057332 3300005201 Bacteria 4562
125 Ga0072941_1068151 3300005201 Bacteria 4043
126 Ga0466713_020473 3300042602 Bacteria 7680
127 Ga0466716_535524 3300042605 Bacteria 2528
128 Ga0466720_074924 3300042607 Bacteria 21256
129 Ga0466720_115436 3300042607 Bacteria 52557
130 Ga0466722_175249 3300042609 Bacteria 63620
131 Ga0466690_031343 3300042590 Bacteria 4104
132 Ga0466691_057666 3300042593 Bacteria 5826
133 Ga0466694_315239 3300042594 Bacteria 4354
134 Ga0466699_093121 3300042597 Bacteria 25575
135 Ga0466699_109702 3300042597 Bacteria 8134
136 Ga0466703_275172 3300042636 Bacteria 10100
137 Ga0466709_335917 3300042648 Bacteria 15035
138 Ga0466712_189837 3300042614 Bacteria 23751
139 Ga0466711_360474 3300042615 Bacteria 28164
140 Ga0466718_012825 3300042617 Bacteria 18566
141 Ga0466718_119244 3300042617 Bacteria 3012
142 Ga0466723_184835 3300042618 Bacteria 7572
143 Ga0466726_479828 3300042619 Bacteria 4768
144 Ga0123356_10000141 3300010049 Bacteria 81679
145 AustNasuHG_c1000119 3300000089 Bacteria 24192
146 JGI24695J34938_10000232 3300002450 Bacteria 52996
147 JGI24695J34938_10000923 3300002450 Bacteria 26875
148 Ga0068305_10295989 3300005083 Bacteria 6587
149 Ga0466720_006827 3300042607 Bacteria 4432
150 Ga0466720_079671 3300042607 Bacteria 3636
151 Ga0466720_110638 3300042607 Bacteria 4151
152 Ga0466720_113294 3300042607 Bacteria 5468
153 Ga0466720_185663 3300042607 Bacteria 15769
154 Ga0466722_060842 3300042609 Bacteria 24383
155 Ga0466705_312810 3300042612 Bacteria 5788
156 Ga0466732_261144 3300042656 Bacteria 13344
157 Ga0264413_119319 3300024493 Bacteria 3054
158 Ga0466690_188286 3300042590 Bacteria 9118
159 Ga0466692_111211 3300042591 Bacteria 6204
160 Ga0466694_036860 3300042594 Bacteria 17716
161 Ga0466694_308561 3300042594 Bacteria 4497
162 Ga0466704_035006 3300042643 Bacteria 22236
163 Ga0466708_277272 3300042652 Bacteria 4136
164 Ga0466708_281390 3300042652 Bacteria 4140
165 Ga0123353_10076817 3300010167 Bacteria 5366
166 JGI24695J34938_10012256 3300002450 Bacteria 4557
167 Ga0466716_122286 3300042605 Bacteria 3721
168 Ga0466720_019969 3300042607 Bacteria 45077
169 Ga0466720_029258 3300042607 Bacteria 50082

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20256 MoCoBD_2 Molybdopterin cofactor-binding domain 616 696 0.95
PF02738 MoCoBD_1 Molybdopterin cofactor-binding domain 196 395 0.9
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 5 80 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02738 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.