Protein Family IF00594

Metagenome Metatranscriptome Isolate
191 Members
54 Samples
163 Scaffolds
241.52 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10000690|JGI24695J34938_100006904
Length
276 aa
Sequence
MESIKKAVTSESNVLEITGLEKNFGGCEALQGVDMIIPAGQITGLLGPNASGKTTLLKTIAGLLQPTAGKISYFQNAAHGPQSRKTVSFCPDTLAFPQWMKVRDAFTFYREMYGDYSQSRADELMRILELQNVQNKYVNKLSKGMKERLVLGLTFSRETQLYLLDEPLDGIDPVGKMRVIDTIIAMKPQDSSTLVSTHLVKDIERIFDSVFFLSKGKIVFSGNSETIREEKGKTVEQAYLEVFTSDNNQLSDVSGYNDLSKARPNSKEDVNESSI*

📊 Sample Types

Isolate 14.7%
Metagenome 84.8%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 51.0%
Termitidae 49.0%

🌳 Taxonomy

Archaea 2
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
3 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
4 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
5 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
9 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
18 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
19 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
20 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
21 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
28 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
29 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
37 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
38 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
41 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
42 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
43 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
48 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
49 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
50 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
51 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
52 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
53 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
54 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000195 3300009826 Bacteria 75423
2 Ga0123356_10032338 3300010049 Bacteria 4894
3 Ga0123356_10407364 3300010049 Bacteria 1499
4 Ga0123356_10426115 3300010049 Bacteria 1470
5 Ga0123356_10598499 3300010049 Bacteria 1267
6 Ga0123353_10094293 3300010167 Bacteria 4822
7 Ga0123353_10242868 3300010167 Bacteria 2796
8 Ga0123353_10267057 3300010167 Bacteria 2639
9 Ga0123353_10405660 3300010167 Bacteria 2026
10 Ga0123353_10417141 3300010167 Bacteria 1990
11 Ga0123353_11277402 3300010167 Bacteria 955
12 Ga0123353_11427188 3300010167 Bacteria 888
13 Ga0123354_10048605 3300010882 Bacteria 6447
14 Ga0123354_10150138 3300010882 Bacteria 2828
15 Ga0466717_226093 3300042604 Unclassified 4564
16 Ga0466720_142541 3300042607 Unclassified 8153
17 Ga0466721_288132 3300042608 Bacteria 15485
18 Ga0415639_018194 3300038395 Bacteria 24853
19 Ga0415639_041582 3300038395 Bacteria 6751
20 Ga0415639_078103 3300038395 Bacteria 2914
21 Ga0466693_297379 3300042592 Unclassified 3795
22 JGI24695J34938_10000690 3300002450 Bacteria 31868
23 JGI24695J34938_10001170 3300002450 Bacteria 23318
24 JGI24695J34938_10011753 3300002450 Unclassified 4696
25 JGI24695J34938_10016750 3300002450 Bacteria 3717
26 JGI24695J34938_10019017 3300002450 Bacteria 3415
27 JGI24695J34938_10020211 3300002450 Bacteria 3281
28 JGI24695J34938_10046159 3300002450 Unclassified 1929
29 Ga0123357_10000232 3300009784 Bacteria 52582
30 Ga0466697_069372 3300042611 Bacteria 1094
31 Ga0466697_248846 3300042611 Unclassified 1208
32 Ga0123355_10254169 3300009826 Bacteria 2468
33 Ga0123356_10006861 3300010049 Bacteria 11454
34 Ga0123356_10012349 3300010049 Bacteria 8294
35 Ga0123356_10042372 3300010049 Bacteria 4241
36 Ga0123356_10043590 3300010049 Bacteria 4177
37 Ga0123356_10150190 3300010049 Bacteria 2312
38 Ga0123356_10225540 3300010049 Bacteria 1934
39 Ga0123356_10721743 3300010049 Bacteria 1166
40 Ga0123356_10982211 3300010049 Unclassified 1015
41 Ga0123356_11106144 3300010049 Bacteria 961
42 Ga0123353_10143542 3300010167 Bacteria 3821
43 Ga0123353_10240291 3300010167 Bacteria 2814
44 Ga0123353_10248705 3300010167 Bacteria 2756
45 Ga0123353_10309792 3300010167 Bacteria 2404
46 Ga0123353_11108501 3300010167 Unclassified 1050
47 Ga0466700_088624 3300042600 Bacteria 14035
48 Ga0466717_062614 3300042604 Bacteria 7640
49 Ga0466720_173712 3300042607 Unclassified 2407
50 Ga0466720_178182 3300042607 Bacteria 14380
51 Ga0466721_232471 3300042608 Unclassified 2983
52 Ga0264413_127382 3300024493 Bacteria 2291
53 Ga0264413_130249 3300024493 Unclassified 7510
54 Ga0415639_000354 3300038395 Bacteria 7044
55 Ga0415639_013521 3300038395 Bacteria 26517
56 JGI24695J34938_10000161 3300002450 Bacteria 62308
57 JGI24695J34938_10003277 3300002450 Bacteria 11420
58 JGI24705J35276_12217229 3300002504 Unclassified 2084
59 Ga0123356_10004402 3300010049 Bacteria 14561
60 Ga0123356_10066157 3300010049 Bacteria 3383
61 Ga0123356_10074108 3300010049 Bacteria 3202
62 Ga0123353_10168252 3300010167 Bacteria 3482
63 Ga0123353_10191334 3300010167 Bacteria 3229
64 Ga0466720_033593 3300042607 Unclassified 1929
65 Ga0223674_1000778 3300021235 Bacteria 2714
66 JGI24695J34938_10000142 3300002450 Bacteria 65463
67 JGI24695J34938_10000374 3300002450 Bacteria 44420
68 JGI24695J34938_10002601 3300002450 Bacteria 13589
69 Ga0072941_1397880 3300005201 Bacteria 3973
70 Ga0466718_004159 3300042617 Bacteria 3467
71 Ga0466718_106600 3300042617 Unclassified 1233
72 Ga0466702_337943 3300042635 Bacteria 2117
73 Ga0466697_224000 3300042611 Unclassified 1840
74 Ga0123356_10001280 3300010049 Bacteria 27849
75 Ga0123356_10529489 3300010049 Bacteria 1337
76 Ga0123356_10563135 3300010049 Unclassified 1302
77 Ga0123353_10000612 3300010167 Bacteria 43701
78 Ga0123353_10053169 3300010167 Bacteria 6473
79 Ga0123353_10648757 3300010167 Bacteria 1495
80 Ga0123353_10855728 3300010167 Bacteria 1245
81 Ga0466700_452348 3300042600 Bacteria 1689
82 Ga0466714_015667 3300042603 Bacteria 1395
83 Ga0466720_230021 3300042607 Unclassified 1897
84 Ga0415639_089949 3300038395 Bacteria 6942
85 AustNasuHG_c1036707 3300000089 Unclassified 1266
86 JGI24695J34938_10049634 3300002450 Unclassified 1843
87 JGI24695J34938_10091944 3300002450 Bacteria 1244
88 Ga0466718_012357 3300042617 Bacteria 4062
89 Ga0466702_226766 3300042635 Bacteria 15165
90 Ga0466725_259301 3300042654 Bacteria 3952
91 Ga0123356_10064351 3300010049 Bacteria 3429
92 Ga0123356_10265967 3300010049 Archaea 1802
93 Ga0123356_10443979 3300010049 Bacteria 1444
94 Ga0123356_10551694 3300010049 Bacteria 1313
95 Ga0123356_10939770 3300010049 Bacteria 1036
96 Ga0123353_10167284 3300010167 Unclassified 3494
97 Ga0123353_10952825 3300010167 Unclassified 1160
98 Ga0466698_027783 3300042610 Bacteria 29400
99 Ga0466698_132716 3300042610 Bacteria 1304
100 Ga0466698_499820 3300042610 Bacteria 2128
101 Ga0264413_110571 3300024493 Bacteria 3856
102 Ga0264413_134053 3300024493 Unclassified 1434
103 Ga0415639_029918 3300038395 Bacteria 4105
104 JGI24695J34938_10008121 3300002450 Bacteria 6040
105 Ga0466718_100409 3300042617 Bacteria 1953
106 Ga0123356_10000230 3300010049 Bacteria 65093
107 Ga0123356_10003892 3300010049 Unclassified 15550
108 Ga0123356_10005165 3300010049 Bacteria 13367
109 Ga0123356_10009368 3300010049 Bacteria 9671
110 Ga0123356_10028277 3300010049 Bacteria 5253
111 Ga0123356_10813467 3300010049 Bacteria 1105
112 Ga0123356_11219519 3300010049 Bacteria 918
113 Ga0123356_11318726 3300010049 Unclassified 885
114 Ga0123353_10049069 3300010167 Bacteria 6724
115 Ga0123353_10068973 3300010167 Bacteria 5679
116 Ga0123353_10076348 3300010167 Archaea 5384
117 Ga0123353_10190248 3300010167 Bacteria 3240
118 Ga0123353_10942903 3300010167 Unclassified 1169
119 Ga0123354_10318545 3300010882 Unclassified 1439
120 Ga0466720_127570 3300042607 Bacteria 1084
121 Ga0415639_027668 3300038395 Bacteria 14268
122 Ga0415639_041583 3300038395 Bacteria 16360
123 Ga0415639_059310 3300038395 Bacteria 5129
124 JGI24695J34938_10000579 3300002450 Bacteria 35323
125 JGI24695J34938_10002142 3300002450 Bacteria 15418
126 Ga0123356_10006775 3300010049 Bacteria 11527
127 Ga0123356_10131691 3300010049 Bacteria 2451
128 Ga0123356_10946718 3300010049 Bacteria 1032
129 Ga0123353_10049810 3300010167 Bacteria 6674
130 Ga0123353_10209724 3300010167 Bacteria 3057
131 Ga0123353_10246051 3300010167 Bacteria 2774
132 Ga0123353_10670607 3300010167 Unclassified 1463
133 Ga0123354_10067938 3300010882 Unclassified 5187
134 Ga0466700_221012 3300042600 Bacteria 15804
135 Ga0466720_121642 3300042607 Unclassified 4608
136 Ga0415639_012542 3300038395 Bacteria 13369
137 Ga0415639_013731 3300038395 Bacteria 9649
138 Ga0415639_049714 3300038395 Bacteria 7275
139 Ga0466693_115016 3300042592 Bacteria 13237
140 Ga0466693_284844 3300042592 Bacteria 28082
141 Ga0466694_198834 3300042594 Bacteria 2174
142 AustNasuHG_c1002301 3300000089 Bacteria 6894
143 JGI24695J34938_10001313 3300002450 Bacteria 21661
144 JGI24702J35022_10000209 3300002462 Bacteria 32335
145 Ga0466731_096956 3300042622 Bacteria 4001
146 Ga0466724_48721 3300042649 Bacteria 3086
147 Ga0466732_252945 3300042656 Bacteria 2652
148 Ga0466732_263586 3300042656 Bacteria 2599
149 Ga0123357_10281788 3300009784 Bacteria 1715
150 Ga0123355_10117418 3300009826 Bacteria 4136
151 Ga0123356_10004529 3300010049 Bacteria 14340
152 Ga0123356_10031138 3300010049 Bacteria 4994
153 Ga0123356_10700624 3300010049 Unclassified 1182
154 Ga0123353_10216678 3300010167 Bacteria 2998
155 Ga0123353_10566041 3300010167 Unclassified 1635
156 Ga0466700_467244 3300042600 Bacteria 1138
157 Ga0466720_147033 3300042607 Bacteria 48792
158 Ga0466720_181329 3300042607 Unclassified 1577
159 Ga0415639_007162 3300038395 Bacteria 11497
160 JGI24695J34938_10000003 3300002450 Bacteria 167365
161 JGI24695J34938_10001690 3300002450 Bacteria 18262
162 JGI24695J34938_10001703 3300002450 Bacteria 18182
163 JGI24695J34938_10003497 3300002450 Bacteria 10919

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 30 168 0.97
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 42 71 0.75

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.