Protein Family IF00579

Metagenome Isolate
184 Members
78 Samples
147 Scaffolds
531.95 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10000057|JGI24695J34938_1000005766
Length
564 aa
Sequence
MSVGMLNIFNTHSSALLVPTLQGVIITMNLKRTEIENTLAWKKMGISLPRFCVSEMCVRTKEAPQWVHFGAGNIFRAFIARISQNLLNLGLVESGIVAVETYDYEIIDRVYKPYSDLSLFVGLKSDGNMDMEVIASVARSLNADSSVEKDWSALHDIFKNPELQLVSVTITEKGYGLYGADGKLLAVVSDDIKSGPSAPRHAMSVVAALLYSRFLSGGAPLALVSMDNCSRNGEVFYKAVYTVAEGWYRNGHVDRAFLDYISDETKVAFPWSMIDKITPYPDDSVYKELTRLGLEGMEPLTTSKNSFTAPFVNAEIPEYLVIEDSFPNGRPPLEKAGVYLTDRETVNKTEKMKVTTCLNPLHTALAVFGCLLGFKKISDMMNDQDMVNLVNRLGYTEGMPVVTDPKIIRPRAFIKEVLEKRLPNPFLPDTPQRIATDTSQKMAIRFGETIRAYMESEALDTAELTVIPLVIAGWLRYLLAVDDNGNEMPLSPDPALGELTALLSDICVGVPNIAGGQLYPILSNAQIFGVNLFDAGLGEKVIKIFNELIAKPGAVREVVRKYT*

📊 Sample Types

Isolate 20.1%
Metagenome 79.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 39.0%
Termitidae 23.4%
Kalotermitidae 18.2%
Apidae 10.4%
Termopsidae 5.2%
Rhinotermitidae 3.9%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
2 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
3 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
4 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
5 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
6 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
17 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
18 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
19 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
20 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
21 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
27 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
30 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
31 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
42 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
43 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
44 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
45 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
46 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
47 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
48 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
52 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
53 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
54 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
60 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
61 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
62 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
63 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
64 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
65 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
66 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
67 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
68 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
69 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
70 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
71 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
74 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
75 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
76 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
77 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
78 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_199238 3300042659 Bacteria 3448
2 Ga0123356_10002180 3300010049 Bacteria 21050
3 Ga0123356_10002783 3300010049 Bacteria 18563
4 Ga0123356_10012630 3300010049 Bacteria 8189
5 Ga0123356_10039994 3300010049 Bacteria 4369
6 Ga0123356_10196779 3300010049 Bacteria 2052
7 Ga0466700_237745 3300042600 Bacteria 1634
8 Ga0466707_098942 3300042601 Bacteria 5155
9 Ga0466713_110078 3300042602 Bacteria 49332
10 Ga0466719_473962 3300042606 Bacteria 3876
11 Ga0466690_283801 3300042590 Bacteria 4881
12 Ga0466696_073454 3300042596 Bacteria 2143
13 Ga0466696_259712 3300042596 Bacteria 29051
14 Ga0466711_035438 3300042615 Bacteria 3516
15 Ga0466723_358872 3300042618 Bacteria 4629
16 Ga0466728_125878 3300042620 Bacteria 24281
17 Ga0466735_103111 3300042624 Bacteria 3679
18 Ga0466703_293360 3300042636 Bacteria 8502
19 Ga0466704_479369 3300042643 Bacteria 8748
20 Ga0466704_538516 3300042643 Bacteria 9487
21 Ga0466727_225171 3300042655 Bacteria 2988
22 Ga0466727_328565 3300042655 Bacteria 4068
23 Ga0466705_008694 3300042612 Bacteria 2121
24 Ga0123357_10059466 3300009784 Bacteria 5128
25 Ga0123355_10002318 3300009826 Bacteria 26885
26 Ga0123355_10003310 3300009826 Bacteria 23053
27 Ga0123356_10000009 3300010049 Bacteria 226788
28 Ga0123356_10095189 3300010049 Bacteria 2846
29 Ga0466716_179312 3300042605 Bacteria 5627
30 Ga0466719_127301 3300042606 Bacteria 9111
31 Ga0466698_157547 3300042610 Bacteria 23432
32 Ga0072941_1000935 3300005201 Bacteria 118687
33 Ga0466696_329767 3300042596 Bacteria 15797
34 Ga0466723_029755 3300042618 Bacteria 48312
35 Ga0466723_101405 3300042618 Bacteria 32576
36 Ga0466703_309775 3300042636 Bacteria 11693
37 Ga0466704_099865 3300042643 Bacteria 12393
38 Ga0466704_303329 3300042643 Bacteria 3449
39 Ga0466709_368918 3300042648 Bacteria 82197
40 Ga0466727_150380 3300042655 Bacteria 3401
41 Ga0466733_086673 3300042659 Bacteria 6275
42 Ga0123357_10210781 3300009784 Bacteria 2183
43 Ga0123355_10009052 3300009826 Bacteria 15092
44 Ga0123355_10043336 3300009826 Bacteria 7321
45 Ga0123355_10062939 3300009826 Bacteria 5987
46 Ga0123355_10309306 3300009826 Bacteria 2144
47 Ga0123353_10024319 3300010167 Bacteria 9193
48 Ga0466713_062099 3300042602 Bacteria 11148
49 Ga0466719_117979 3300042606 Bacteria 6960
50 Ga0466719_121895 3300042606 Bacteria 15848
51 Ga0466719_295739 3300042606 Bacteria 21474
52 Ga0466719_303212 3300042606 Bacteria 94930
53 Ga0466722_081863 3300042609 Bacteria 13861
54 JGI24695J34938_10000057 3300002450 Bacteria 89669
55 JGI24700J35501_10930934 3300002508 Bacteria 66586
56 Ga0068305_10009261 3300005083 Unclassified 4197
57 Ga0415639_075635 3300038395 Bacteria 4807
58 Ga0466690_200100 3300042590 Bacteria 11962
59 Ga0466691_119084 3300042593 Bacteria 39836
60 Ga0466691_158402 3300042593 Bacteria 3927
61 Ga0466715_036720 3300042616 Bacteria 9199
62 Ga0466723_069694 3300042618 Bacteria 3874
63 Ga0466703_106697 3300042636 Bacteria 53394
64 Ga0466708_003745 3300042652 Bacteria 6833
65 Ga0466727_093204 3300042655 Bacteria 3801
66 Ga0466705_069098 3300042612 Bacteria 10056
67 Ga0466705_110916 3300042612 Bacteria 65673
68 Ga0123353_10040308 3300010167 Bacteria 7367
69 Ga0466696_493332 3300042596 Bacteria 5644
70 Ga0466705_436087 3300042612 Bacteria 4422
71 Ga0466715_111177 3300042616 Bacteria 1957
72 Ga0466715_244540 3300042616 Bacteria 16421
73 Ga0466715_421137 3300042616 Bacteria 6577
74 Ga0466715_459474 3300042616 Bacteria 3985
75 Ga0466726_182456 3300042619 Bacteria 3469
76 Ga0466702_448230 3300042635 Bacteria 4728
77 Ga0466703_146010 3300042636 Bacteria 3999
78 Ga0466703_212971 3300042636 Bacteria 3569
79 Ga0123355_10039198 3300009826 Bacteria 7707
80 Ga0123355_10165151 3300009826 Bacteria 3324
81 Ga0466707_248668 3300042601 Bacteria 1712
82 Ga0466714_006804 3300042603 Bacteria 4388
83 Ga0466714_164808 3300042603 Bacteria 1605
84 Ga0466716_151046 3300042605 Bacteria 19901
85 Ga0466721_285206 3300042608 Bacteria 28917
86 JGI24702J35022_10001499 3300002462 Bacteria 14498
87 Ga0466692_014346 3300042591 Bacteria 6661
88 Ga0466696_010294 3300042596 Bacteria 27939
89 Ga0466696_116428 3300042596 Bacteria 8392
90 Ga0466696_123484 3300042596 Bacteria 9563
91 Ga0466696_452388 3300042596 Bacteria 5072
92 Ga0466715_321032 3300042616 Bacteria 166710
93 Ga0466723_106096 3300042618 Bacteria 28128
94 Ga0466728_094658 3300042620 Bacteria 11034
95 Ga0466725_259712 3300042654 Bacteria 12556
96 Ga0466713_025243 3300042602 Bacteria 12014
97 Ga0466714_150022 3300042603 Bacteria 3774
98 Ga0068302_10395563 3300005071 Bacteria 1908
99 Ga0466693_234840 3300042592 Bacteria 1841
100 Ga0466696_290089 3300042596 Bacteria 9192
101 Ga0466711_181310 3300042615 Bacteria 18546
102 Ga0466715_325083 3300042616 Bacteria 37633
103 Ga0466703_321499 3300042636 Bacteria 9354
104 Ga0466704_337647 3300042643 Bacteria 10905
105 Ga0466704_515801 3300042643 Bacteria 57837
106 Ga0466709_222083 3300042648 Bacteria 2835
107 Ga0466705_050308 3300042612 Bacteria 4620
108 Ga0123355_10003176 3300009826 Bacteria 23461
109 Ga0123355_10023344 3300009826 Bacteria 9932
110 Ga0123355_10090620 3300009826 Bacteria 4850
111 Ga0123356_10125629 3300010049 Bacteria 2503
112 Ga0123353_10000269 3300010167 Bacteria 64830
113 Ga0466700_063771 3300042600 Bacteria 96209
114 Ga0466707_309035 3300042601 Unclassified 3912
115 Ga0466713_029057 3300042602 Bacteria 5290
116 Ga0466714_071785 3300042603 Bacteria 2910
117 Ga0466714_128332 3300042603 Bacteria 98615
118 Ga0466716_000163 3300042605 Bacteria 3102
119 JGI24695J34938_10006918 3300002450 Bacteria 6732
120 Ga0068305_10002306 3300005083 Bacteria 48693
121 Ga0466691_042856 3300042593 Bacteria 6642
122 Ga0466711_364085 3300042615 Bacteria 228323
123 Ga0466715_593419 3300042616 Bacteria 37491
124 Ga0466726_241035 3300042619 Bacteria 10868
125 Ga0466729_123862 3300042621 Bacteria 45856
126 Ga0466703_270850 3300042636 Bacteria 13720
127 Ga0466708_377185 3300042652 Bacteria 4221
128 Ga0466727_304622 3300042655 Bacteria 4543
129 Ga0123355_10000182 3300009826 Bacteria 77682
130 Ga0123356_10002282 3300010049 Bacteria 20654
131 Ga0123356_10010058 3300010049 Bacteria 9303
132 Ga0466714_003848 3300042603 Bacteria 22429
133 Ga0466714_086830 3300042603 Bacteria 8301
134 Ga0466714_114674 3300042603 Bacteria 18871
135 Ga0466716_053025 3300042605 Bacteria 4120
136 Ga0466719_014220 3300042606 Bacteria 7815
137 Ga0466722_102355 3300042609 Bacteria 2435
138 Ga0072941_1071609 3300005201 Bacteria 12714
139 Ga0466696_021324 3300042596 Bacteria 9070
140 Ga0466696_029290 3300042596 Bacteria 39093
141 Ga0466711_048496 3300042615 Bacteria 16827
142 Ga0466715_241955 3300042616 Bacteria 3486
143 Ga0466728_083856 3300042620 Bacteria 5780
144 Ga0466704_011570 3300042643 Bacteria 91516
145 Ga0466704_506267 3300042643 Bacteria 10877
146 Ga0466709_039865 3300042648 Bacteria 21232
147 Ga0466708_021980 3300042652 Bacteria 6979

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 347 499 0.85
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 66 334 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08125 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.