Protein Family IF00548
Metagenome
Isolate
151
Members
36
Samples
142
Scaffolds
344.23
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10068548|JGI24698J34947_100685481
- Length
- 349 aa
- Sequence
- MSIHGYNYIMEIDKKTFGILSNGKKVKIYTLSAGDLTLSLTNFGAAWTSLIVPSRKGAADVLLGFSGLNGYLNNGSFLGVTVGRFANRIKGASFTIDGVTYRLEATDGQNTLHSGKRGFDKLXWKAEEYEDGGGVYVRFELDSPDGDCGFPGNLKAVVTYGLTKSNELIADYRARVDRQCPVNLTNHAYFNLAGEGKGSILSHEILLYSSTYVEVDRHNIPTGRIVPAEGAFDFRTRRRINSRPGLFRGYDHCFVVDGEIGKLRPCAEVYEHDSGRFMKVSTTQPGVQFYTGNHLNIEGKYGSRYVKHSGFCLETQHFPDTPNQAAFPSCTVDPDKDYHEKAVFSFDW*
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
67.6%
Unclassified
26.5%
Rhinotermitidae
5.9%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 21 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 22 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 23 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 26 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10008431 | 3300010049 | Bacteria | 10250 |
| 2 | Ga0123353_10127182 | 3300010167 | Bacteria | 4094 |
| 3 | Ga0466699_037813 | 3300042597 | Unclassified | 6398 |
| 4 | JGI24698J34947_10000336 | 3300002449 | Bacteria | 20784 |
| 5 | Ga0072941_1034166 | 3300005201 | Bacteria | 6442 |
| 6 | Ga0072941_1107745 | 3300005201 | Bacteria | 6251 |
| 7 | Ga0466731_429616 | 3300042622 | Bacteria | 6294 |
| 8 | Ga0466712_177584 | 3300042614 | Bacteria | 9577 |
| 9 | Ga0466720_064489 | 3300042607 | Bacteria | 4513 |
| 10 | Ga0123356_10000425 | 3300010049 | Bacteria | 48140 |
| 11 | Ga0264413_106450 | 3300024493 | Bacteria | 14192 |
| 12 | Ga0264413_114824 | 3300024493 | Bacteria | 5432 |
| 13 | Ga0264413_124163 | 3300024493 | Bacteria | 2054 |
| 14 | Ga0466694_058636 | 3300042594 | Bacteria | 21238 |
| 15 | JGI24698J34947_10000063 | 3300002449 | Bacteria | 33343 |
| 16 | JGI24698J34947_10006700 | 3300002449 | Bacteria | 6325 |
| 17 | JGI24698J34947_10008218 | 3300002449 | Bacteria | 5726 |
| 18 | JGI24698J34947_10008367 | 3300002449 | Unclassified | 5677 |
| 19 | JGI24698J34947_10010239 | 3300002449 | Bacteria | 5141 |
| 20 | JGI24698J34947_10082379 | 3300002449 | Unclassified | 1504 |
| 21 | JGI24695J34938_10003243 | 3300002450 | Bacteria | 11509 |
| 22 | JGI24695J34938_10038241 | 3300002450 | Bacteria | 2174 |
| 23 | JGI24695J34938_10050096 | 3300002450 | Bacteria | 1833 |
| 24 | Ga0072941_1005723 | 3300005201 | Bacteria | 33074 |
| 25 | Ga0074263_112393 | 3300005485 | Unclassified | 2445 |
| 26 | Ga0466712_002765 | 3300042614 | Bacteria | 3288 |
| 27 | Ga0466712_113713 | 3300042614 | Bacteria | 3963 |
| 28 | Ga0466712_187647 | 3300042614 | Bacteria | 2395 |
| 29 | Ga0466712_264940 | 3300042614 | Bacteria | 25363 |
| 30 | Ga0466718_037316 | 3300042617 | Bacteria | 3730 |
| 31 | Ga0466718_113217 | 3300042617 | Bacteria | 4134 |
| 32 | Ga0466700_099697 | 3300042600 | Bacteria | 9868 |
| 33 | Ga0466720_063730 | 3300042607 | Bacteria | 6174 |
| 34 | Ga0466698_215730 | 3300042610 | Bacteria | 24389 |
| 35 | Ga0123356_10000351 | 3300010049 | Bacteria | 52507 |
| 36 | Ga0123356_10001400 | 3300010049 | Bacteria | 26708 |
| 37 | Ga0264413_101219 | 3300024493 | Bacteria | 6404 |
| 38 | Ga0466699_094472 | 3300042597 | Bacteria | 2516 |
| 39 | JGI24698J34947_10068548 | 3300002449 | Bacteria | 1715 |
| 40 | Ga0072940_1169700 | 3300005200 | Bacteria | 2014 |
| 41 | Ga0072941_1005668 | 3300005201 | Bacteria | 10675 |
| 42 | Ga0072941_1006916 | 3300005201 | Bacteria | 30596 |
| 43 | Ga0466702_442086 | 3300042635 | Bacteria | 1425 |
| 44 | Ga0466712_023839 | 3300042614 | Bacteria | 59773 |
| 45 | Ga0466712_147699 | 3300042614 | Bacteria | 6071 |
| 46 | Ga0466712_237745 | 3300042614 | Bacteria | 17404 |
| 47 | Ga0466712_245674 | 3300042614 | Bacteria | 5091 |
| 48 | Ga0466718_002045 | 3300042617 | Bacteria | 9899 |
| 49 | Ga0466718_018975 | 3300042617 | Bacteria | 6692 |
| 50 | Ga0466718_022159 | 3300042617 | Bacteria | 13693 |
| 51 | Ga0466720_047674 | 3300042607 | Bacteria | 3369 |
| 52 | Ga0466720_113854 | 3300042607 | Bacteria | 8150 |
| 53 | Ga0123356_10004159 | 3300010049 | Bacteria | 15019 |
| 54 | Ga0123356_10364938 | 3300010049 | Bacteria | 1572 |
| 55 | Ga0264413_105951 | 3300024493 | Bacteria | 20514 |
| 56 | AustNasuHG_c1000377 | 3300000089 | Bacteria | 15487 |
| 57 | JGI24698J34947_10002486 | 3300002449 | Bacteria | 9955 |
| 58 | JGI24698J34947_10007378 | 3300002449 | Bacteria | 6044 |
| 59 | Ga0074263_110804 | 3300005485 | Bacteria | 2122 |
| 60 | Ga0466712_013430 | 3300042614 | Bacteria | 12564 |
| 61 | Ga0466712_042362 | 3300042614 | Bacteria | 32694 |
| 62 | Ga0466712_144071 | 3300042614 | Bacteria | 18902 |
| 63 | Ga0466712_226164 | 3300042614 | Bacteria | 14979 |
| 64 | Ga0466718_021742 | 3300042617 | Bacteria | 6394 |
| 65 | Ga0466722_074556 | 3300042609 | Unclassified | 12390 |
| 66 | Ga0123356_10007744 | 3300010049 | Bacteria | 10696 |
| 67 | Ga0123356_10108998 | 3300010049 | Bacteria | 2671 |
| 68 | Ga0123356_10133050 | 3300010049 | Bacteria | 2440 |
| 69 | Ga0123356_10200513 | 3300010049 | Bacteria | 2035 |
| 70 | Ga0264413_101220 | 3300024493 | Bacteria | 47245 |
| 71 | Ga0264413_106451 | 3300024493 | Bacteria | 6181 |
| 72 | Ga0415639_028269 | 3300038395 | Bacteria | 6214 |
| 73 | Ga0466694_023923 | 3300042594 | Bacteria | 8230 |
| 74 | AustNasuHG_c1001485 | 3300000089 | Bacteria | 8405 |
| 75 | AustNasuHG_c1002532 | 3300000089 | Bacteria | 6607 |
| 76 | AustNasuHG_c1020320 | 3300000089 | Bacteria | 2164 |
| 77 | JGI24698J34947_10005392 | 3300002449 | Bacteria | 7016 |
| 78 | JGI24698J34947_10006551 | 3300002449 | Bacteria | 6394 |
| 79 | JGI24698J34947_10008393 | 3300002449 | Bacteria | 5670 |
| 80 | JGI24698J34947_10029172 | 3300002449 | Bacteria | 2917 |
| 81 | JGI24695J34938_10002404 | 3300002450 | Bacteria | 14374 |
| 82 | Ga0072941_1034337 | 3300005201 | Bacteria | 5528 |
| 83 | Ga0466702_054127 | 3300042635 | Bacteria | 9159 |
| 84 | Ga0466712_146906 | 3300042614 | Bacteria | 3409 |
| 85 | Ga0466718_015773 | 3300042617 | Bacteria | 16307 |
| 86 | Ga0466732_364253 | 3300042656 | Bacteria | 2451 |
| 87 | Ga0466721_061177 | 3300042608 | Bacteria | 2028 |
| 88 | Ga0123356_10002382 | 3300010049 | Bacteria | 20132 |
| 89 | Ga0123356_10005499 | 3300010049 | Bacteria | 12895 |
| 90 | Ga0415639_060855 | 3300038395 | Bacteria | 7564 |
| 91 | AustNasuHG_c1002653 | 3300000089 | Bacteria | 6459 |
| 92 | JGI24698J34947_10000682 | 3300002449 | Bacteria | 16591 |
| 93 | JGI24698J34947_10001448 | 3300002449 | Bacteria | 12467 |
| 94 | JGI24698J34947_10007027 | 3300002449 | Bacteria | 6188 |
| 95 | JGI24698J34947_10009634 | 3300002449 | Bacteria | 5293 |
| 96 | JGI24695J34938_10012534 | 3300002450 | Bacteria | 4488 |
| 97 | JGI24695J34938_10020696 | 3300002450 | Bacteria | 3232 |
| 98 | Ga0072940_1042624 | 3300005200 | Bacteria | 2479 |
| 99 | Ga0072940_1254687 | 3300005200 | Bacteria | 2893 |
| 100 | Ga0072941_1005670 | 3300005201 | Bacteria | 1999 |
| 101 | Ga0466731_365492 | 3300042622 | Bacteria | 2766 |
| 102 | Ga0466702_128652 | 3300042635 | Bacteria | 5357 |
| 103 | Ga0466702_177072 | 3300042635 | Bacteria | 1652 |
| 104 | Ga0466720_023164 | 3300042607 | Bacteria | 11554 |
| 105 | Ga0466720_114725 | 3300042607 | Bacteria | 41718 |
| 106 | Ga0466720_182937 | 3300042607 | Bacteria | 5637 |
| 107 | Ga0264413_109896 | 3300024493 | Bacteria | 4115 |
| 108 | Ga0466694_294435 | 3300042594 | Bacteria | 2291 |
| 109 | Ga0466694_391849 | 3300042594 | Bacteria | 7415 |
| 110 | Ga0466695_091046 | 3300042595 | Bacteria | 29831 |
| 111 | Ga0466699_075155 | 3300042597 | Bacteria | 4863 |
| 112 | JGI24698J34947_10005654 | 3300002449 | Bacteria | 6853 |
| 113 | JGI24702J35022_10076500 | 3300002462 | Bacteria | 1809 |
| 114 | Ga0466702_305910 | 3300042635 | Bacteria | 3360 |
| 115 | Ga0466712_009153 | 3300042614 | Bacteria | 9828 |
| 116 | Ga0466712_179511 | 3300042614 | Bacteria | 3282 |
| 117 | Ga0466712_234692 | 3300042614 | Bacteria | 10452 |
| 118 | Ga0466718_031802 | 3300042617 | Bacteria | 5036 |
| 119 | Ga0466732_115637 | 3300042656 | Bacteria | 2618 |
| 120 | Ga0466732_136734 | 3300042656 | Bacteria | 1412 |
| 121 | Ga0466717_209392 | 3300042604 | Bacteria | 1199 |
| 122 | Ga0466720_006450 | 3300042607 | Bacteria | 22815 |
| 123 | Ga0466720_056130 | 3300042607 | Bacteria | 6603 |
| 124 | Ga0123356_10026789 | 3300010049 | Bacteria | 5408 |
| 125 | Ga0264413_121420 | 3300024493 | Bacteria | 4542 |
| 126 | Ga0466692_100941 | 3300042591 | Bacteria | 1862 |
| 127 | Ga0466693_011165 | 3300042592 | Bacteria | 16366 |
| 128 | Ga0466699_199041 | 3300042597 | Bacteria | 6294 |
| 129 | AustNasuHG_c1005172 | 3300000089 | Unclassified | 4663 |
| 130 | AustNasuHG_c1014274 | 3300000089 | Bacteria | 2706 |
| 131 | AustNasuHG_c1024300 | 3300000089 | Unclassified | 1921 |
| 132 | JGI24698J34947_10002805 | 3300002449 | Bacteria | 9446 |
| 133 | JGI24698J34947_10011279 | 3300002449 | Bacteria | 4907 |
| 134 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 135 | JGI24695J34938_10000064 | 3300002450 | Bacteria | 87537 |
| 136 | Ga0072941_1005669 | 3300005201 | Bacteria | 6741 |
| 137 | Ga0072941_1005947 | 3300005201 | Bacteria | 19310 |
| 138 | Ga0072941_1009947 | 3300005201 | Bacteria | 24070 |
| 139 | Ga0072941_1060985 | 3300005201 | Unclassified | 2827 |
| 140 | Ga0072941_1107748 | 3300005201 | Bacteria | 2194 |
| 141 | Ga0466702_149333 | 3300042635 | Bacteria | 8423 |
| 142 | Ga0466712_017964 | 3300042614 | Bacteria | 12881 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01263 | Aldose_epim | Aldose 1-epimerase | 28 | 342 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.