Protein Family IF00503

Metagenome Isolate
222 Members
59 Samples
203 Scaffolds
1143.96 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10011609|JGI24698J34947_100116093
Length
1025 aa
Sequence
MNTLSFPELLEKTSASKSVSPLLSALGEDKFPIEIEGSEGSFTALLLAKAYSCTGGRFXAVVPQESDADELLSDLAFSGIPCMKFPWWGTAPYRELKAFSPVFSQRAKVLSAIATGSPGIVIIPQRALVTPVPSRDYVMSLLVSLRPGGRIDTAALAKTLVSYGYTRVPRVQVHGEFALRGEVLDIFMGGDEDAYRVLFDFDKVETIKQFDPAMQGTGGRELPQLVIRPIREVVWTDERIEVLERNLASLKEFSGGASGVIEELISLRYADGXEMFYPLAFDXTETLLDYLDVEGTLVLIDSERLNNAQESLRREYRGFYARALREGRNYPAPERLLLDFQSMLERRVKLSPRVVYFRTIRSEAEEGICHIELSXEPARSFFGNIDYLKEEFASLLKGGWRIAVASQSQVQAERIKTILAFPAEPSGGDGRAPEPHNALSIMACPLTAGFSLPDIKLMVVQENEIFGRRKRPSRSLRTVRSSPIDTFVELNPGDYIVHVNHGIGLFKGIERLSALGHERDYIHIEYAGEESVFVPVEQVNLVQRYIGNEGQPPRLDVLGSKSWENRKGRVKKSVEDIAEKLIELYSKRKQAKGFAFPKDTEWQTMFEAAFPFEETEDQLRCVEEIKQDMESPHPMDRIVCGDVGYGKTEVALRACFKAIMGGKQTAFLAPTTILSEQHYENFRERFSGFPVNVAMLSRFVNSKSTRVIIEQLKKGEIDLLIGTHRIIQRDVQFRNLGLIVIDEEQRFGVKDKEKLKELKTNVDCLTLSATPIPRTLHMSLVKIRDMSLLATAPPGRLPIETFVDEYDDERLAKAIRREVRRGGQVFYLHNRVETLNDTRYKLEKLVPEMLIETAHGQMDARELEDVMHRFIHGGFHVLVSTTIIENGIDIPNVNTIIIDRADMYGVSQLYQLRGRVGRSDRVAYAYLFYPRQRSLSEIAMKRLQTISDFTELGSGFKIAMKDMEIRGAGNLLGREQSGDIYSVGFDLYVRLLEEPSVALRTPVTKGKPKPCLSLSIQASFPTRT*

📊 Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.1%
Termitidae 33.3%
Kalotermitidae 24.6%
Rhinotermitidae 3.5%
Termopsidae 3.5%

🌳 Taxonomy

Archaea 0
Bacteria 219
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
7 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
10 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
18 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
19 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
25 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
37 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
38 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
41 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
42 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
43 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
44 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
45 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
53 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
54 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_238333 3300042600 Bacteria 11294
2 Ga0466716_108906 3300042605 Bacteria 13604
3 Ga0466719_049318 3300042606 Bacteria 9714
4 Ga0466719_056173 3300042606 Bacteria 6793
5 Ga0466719_140800 3300042606 Bacteria 7992
6 Ga0466720_035638 3300042607 Bacteria 16798
7 Ga0466722_000511 3300042609 Bacteria 9118
8 Ga0123356_10000042 3300010049 Bacteria 135091
9 Ga0072941_1026268 3300005201 Bacteria 12709
10 Ga0466711_023414 3300042615 Bacteria 21866
11 Ga0466711_307310 3300042615 Bacteria 7112
12 Ga0466715_395141 3300042616 Bacteria 12828
13 Ga0466718_002548 3300042617 Bacteria 25952
14 Ga0466718_047176 3300042617 Bacteria 24660
15 Ga0466723_216070 3300042618 Bacteria 7278
16 Ga0415639_036607 3300038395 Bacteria 19698
17 Ga0466690_082340 3300042590 Bacteria 17875
18 Ga0466694_009885 3300042594 Bacteria 13426
19 Ga0466705_150211 3300042612 Bacteria 7893
20 Ga0466702_447534 3300042635 Bacteria 9870
21 Ga0466703_325863 3300042636 Bacteria 8217
22 Ga0466704_333824 3300042643 Bacteria 21099
23 Ga0466708_025229 3300042652 Bacteria 13728
24 Ga0466722_060651 3300042609 Bacteria 10346
25 Ga0123356_10001261 3300010049 Bacteria 27987
26 Ga0123353_10022311 3300010167 Bacteria 9540
27 JGI24698J34947_10001912 3300002449 Bacteria 11086
28 JGI24698J34947_10003525 3300002449 Bacteria 8489
29 JGI24695J34938_10000078 3300002450 Bacteria 82675
30 JGI24695J34938_10001408 3300002450 Bacteria 20514
31 JGI24695J34938_10001474 3300002450 Bacteria 19891
32 JGI24695J34938_10001559 3300002450 Bacteria 19318
33 Ga0072941_1000025 3300005201 Bacteria 12772
34 Ga0466712_000948 3300042614 Bacteria 18945
35 Ga0466712_071666 3300042614 Bacteria 10781
36 Ga0466711_301028 3300042615 Bacteria 8657
37 Ga0466715_011204 3300042616 Bacteria 9751
38 Ga0466723_047012 3300042618 Bacteria 39235
39 Ga0466728_067000 3300042620 Bacteria 10024
40 Ga0466694_016312 3300042594 Bacteria 13113
41 Ga0466696_156179 3300042596 Bacteria 10206
42 Ga0466709_172904 3300042648 Bacteria 14335
43 Ga0466709_311433 3300042648 Bacteria 9687
44 Ga0466708_006119 3300042652 Bacteria 8932
45 Ga0466708_150246 3300042652 Bacteria 29417
46 Ga0466727_243860 3300042655 Bacteria 15153
47 Ga0466733_209667 3300042659 Bacteria 67326
48 Ga0466720_153984 3300042607 Bacteria 17728
49 Ga0466722_091642 3300042609 Bacteria 16538
50 Ga0466722_254592 3300042609 Bacteria 4018
51 Ga0123355_10003855 3300009826 Bacteria 21692
52 Ga0123355_10008175 3300009826 Bacteria 15799
53 JGI24695J34938_10000066 3300002450 Bacteria 87156
54 Ga0466712_082108 3300042614 Bacteria 22220
55 Ga0466712_092925 3300042614 Bacteria 20208
56 Ga0466712_233820 3300042614 Bacteria 43972
57 Ga0466712_301960 3300042614 Bacteria 8995
58 Ga0466718_046311 3300042617 Bacteria 10585
59 Ga0466718_088323 3300042617 Bacteria 36192
60 Ga0466718_128036 3300042617 Bacteria 29323
61 Ga0466723_229569 3300042618 Bacteria 135891
62 Ga0466728_358911 3300042620 Bacteria 19107
63 Ga0466690_160606 3300042590 Bacteria 3862
64 Ga0466692_058889 3300042591 Bacteria 41705
65 Ga0466696_435701 3300042596 Bacteria 8824
66 Ga0466699_015973 3300042597 Bacteria 123791
67 Ga0466699_147011 3300042597 Bacteria 23668
68 Ga0466699_309521 3300042597 Bacteria 37273
69 Ga0466705_013726 3300042612 Bacteria 31494
70 Ga0466705_290748 3300042612 Bacteria 9050
71 Ga0466703_108679 3300042636 Bacteria 8151
72 Ga0466703_125283 3300042636 Bacteria 47897
73 Ga0466704_228960 3300042643 Bacteria 7328
74 Ga0466708_151975 3300042652 Bacteria 4550
75 Ga0466708_417541 3300042652 Bacteria 43144
76 Ga0466719_138188 3300042606 Bacteria 5187
77 Ga0466720_190326 3300042607 Bacteria 21257
78 Ga0123356_10004149 3300010049 Bacteria 15035
79 JGI24698J34947_10003063 3300002449 Bacteria 9049
80 JGI24695J34938_10000309 3300002450 Bacteria 48089
81 JGI24695J34938_10001272 3300002450 Bacteria 22121
82 Ga0072941_1006819 3300005201 Unclassified 5647
83 Ga0466712_077559 3300042614 Bacteria 4235
84 Ga0466711_038973 3300042615 Bacteria 29172
85 Ga0466718_033388 3300042617 Bacteria 14281
86 Ga0466718_039438 3300042617 Bacteria 14117
87 Ga0466718_060318 3300042617 Bacteria 11613
88 Ga0466723_150825 3300042618 Bacteria 28092
89 Ga0466726_032541 3300042619 Bacteria 6123
90 Ga0466726_047841 3300042619 Bacteria 18790
91 Ga0264413_102635 3300024493 Bacteria 31556
92 Ga0466691_080304 3300042593 Bacteria 14888
93 Ga0466691_120502 3300042593 Bacteria 20132
94 Ga0466691_200294 3300042593 Bacteria 5662
95 Ga0466705_040600 3300042612 Unclassified 2991
96 Ga0466702_343100 3300042635 Bacteria 12563
97 Ga0466703_097389 3300042636 Bacteria 65902
98 Ga0466708_129363 3300042652 Bacteria 25678
99 Ga0466716_399143 3300042605 Bacteria 4556
100 Ga0466716_536266 3300042605 Bacteria 7784
101 Ga0466719_033472 3300042606 Bacteria 4400
102 Ga0466719_306213 3300042606 Bacteria 7800
103 Ga0466722_000578 3300042609 Bacteria 7207
104 Ga0466722_205138 3300042609 Bacteria 6904
105 JGI24695J34938_10001698 3300002450 Bacteria 18200
106 JGI24695J34938_10003130 3300002450 Bacteria 11785
107 Ga0466712_012241 3300042614 Bacteria 49075
108 Ga0466712_039776 3300042614 Bacteria 17547
109 Ga0466711_048633 3300042615 Bacteria 6673
110 Ga0466715_026144 3300042616 Bacteria 4342
111 Ga0466715_054271 3300042616 Bacteria 9457
112 Ga0466690_098253 3300042590 Bacteria 5485
113 Ga0466690_353963 3300042590 Unclassified 8517
114 Ga0466691_112728 3300042593 Bacteria 6008
115 Ga0466705_046320 3300042612 Bacteria 5415
116 Ga0466705_156012 3300042612 Bacteria 12111
117 Ga0466705_204736 3300042612 Bacteria 18205
118 Ga0466703_095936 3300042636 Bacteria 5659
119 Ga0466703_202376 3300042636 Bacteria 4283
120 Ga0466704_130381 3300042643 Bacteria 5516
121 Ga0466704_354677 3300042643 Bacteria 30303
122 Ga0466733_166717 3300042659 Bacteria 87248
123 Ga0466716_159615 3300042605 Bacteria 16703
124 Ga0466722_013846 3300042609 Bacteria 6369
125 Ga0466722_069416 3300042609 Bacteria 6529
126 Ga0123356_10003757 3300010049 Bacteria 15821
127 Ga0123356_10030438 3300010049 Bacteria 5052
128 Ga0123356_10055628 3300010049 Bacteria 3686
129 JGI24695J34938_10001201 3300002450 Bacteria 22950
130 JGI24695J34938_10004659 3300002450 Bacteria 8906
131 Ga0466712_222278 3300042614 Bacteria 31450
132 Ga0466715_025004 3300042616 Bacteria 13217
133 Ga0466715_127378 3300042616 Bacteria 17260
134 Ga0466723_097476 3300042618 Bacteria 16011
135 Ga0466723_344578 3300042618 Bacteria 12792
136 Ga0466726_145189 3300042619 Bacteria 22637
137 Ga0264413_106621 3300024493 Bacteria 23503
138 Ga0466692_101080 3300042591 Bacteria 5151
139 Ga0466691_021546 3300042593 Bacteria 6091
140 Ga0466691_089239 3300042593 Bacteria 12278
141 Ga0466691_089496 3300042593 Bacteria 28725
142 Ga0466691_127318 3300042593 Bacteria 25819
143 Ga0466694_298637 3300042594 Bacteria 15121
144 Ga0466695_129390 3300042595 Bacteria 20502
145 Ga0466699_051819 3300042597 Bacteria 6706
146 Ga0466705_382827 3300042612 Bacteria 5746
147 Ga0466703_069950 3300042636 Bacteria 6894
148 Ga0466703_091197 3300042636 Bacteria 25667
149 Ga0466703_248943 3300042636 Bacteria 7881
150 Ga0466704_108038 3300042643 Bacteria 18603
151 Ga0466708_163518 3300042652 Bacteria 5462
152 Ga0466707_301029 3300042601 Bacteria 7956
153 Ga0466719_225394 3300042606 Bacteria 70315
154 Ga0123357_10049318 3300009784 Bacteria 5702
155 Ga0123356_10000380 3300010049 Bacteria 50618
156 Ga0123356_10000504 3300010049 Bacteria 43651
157 AustNasuHG_c1000091 3300000089 Bacteria 26251
158 AustNasuHG_c1001942 3300000089 Bacteria 7446
159 JGI24698J34947_10000699 3300002449 Bacteria 16416
160 JGI24702J35022_10001060 3300002462 Bacteria 17188
161 JGI24702J35022_10001839 3300002462 Bacteria 13071
162 Ga0466711_034799 3300042615 Bacteria 18162
163 Ga0466715_578998 3300042616 Bacteria 24023
164 Ga0466723_028725 3300042618 Bacteria 9289
165 Ga0466723_092332 3300042618 Bacteria 5308
166 Ga0466723_246232 3300042618 Bacteria 7513
167 Ga0264413_102523 3300024493 Bacteria 4631
168 Ga0466690_345326 3300042590 Bacteria 4324
169 Ga0466691_173255 3300042593 Bacteria 5360
170 Ga0466703_020216 3300042636 Bacteria 9558
171 Ga0466703_140678 3300042636 Bacteria 5817
172 Ga0466703_400669 3300042636 Bacteria 8226
173 Ga0466703_401120 3300042636 Bacteria 23838
174 Ga0466704_565861 3300042643 Bacteria 62930
175 Ga0466709_027107 3300042648 Bacteria 28864
176 Ga0466716_234878 3300042605 Bacteria 10696
177 Ga0466716_331501 3300042605 Bacteria 9506
178 Ga0466722_181926 3300042609 Bacteria 13941
179 JGI24698J34947_10011609 3300002449 Bacteria 4836
180 JGI24695J34938_10000012 3300002450 Bacteria 126955
181 JGI24702J35022_10011533 3300002462 Bacteria 4923
182 Ga0123357_10000034 3300009784 Bacteria 113349
183 Ga0466712_153987 3300042614 Bacteria 26468
184 Ga0466711_341939 3300042615 Bacteria 29295
185 Ga0466715_424506 3300042616 Bacteria 10192
186 Ga0466718_038912 3300042617 Bacteria 18225
187 Ga0466718_092209 3300042617 Bacteria 73198
188 Ga0466723_052961 3300042618 Bacteria 34600
189 Ga0466726_035140 3300042619 Bacteria 13387
190 Ga0415639_033712 3300038395 Bacteria 11053
191 Ga0466690_068104 3300042590 Bacteria 7646
192 Ga0466691_180433 3300042593 Bacteria 5576
193 Ga0466694_077871 3300042594 Bacteria 71235
194 Ga0466696_031044 3300042596 Bacteria 39264
195 Ga0466731_012364 3300042622 Bacteria 28543
196 Ga0466703_046184 3300042636 Bacteria 8350
197 Ga0466703_101873 3300042636 Bacteria 27649
198 Ga0466704_066616 3300042643 Bacteria 7580
199 Ga0466709_119016 3300042648 Bacteria 7209
200 Ga0466709_395944 3300042648 Bacteria 17264
201 Ga0466708_137774 3300042652 Bacteria 20645
202 Ga0466727_076610 3300042655 Bacteria 14083
203 Ga0466727_246918 3300042655 Bacteria 9050

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02559 CarD_TRCF_RID CarD-like/TRCF RID domain 490 546 0.99
PF00271 Helicase_C Helicase conserved C-terminal domain 812 919 0.9
PF17757 UvrB_inter UvrB interaction domain 143 229 0.9
PF00270 DEAD DEAD/DEAH box helicase 615 776 0.85
PF04851 ResIII Type III restriction enzyme, res subunit 616 771 0.77

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.