Protein Family IF00495
Metagenome
Isolate
110
Members
26
Samples
107
Scaffolds
219.39
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10008776|JGI24698J34947_100087766
- Length
- 251 aa
- Sequence
- VKRFNSGIYRSRIFTTEFHGGKTIFILKVLKLRVLRGYLFFLLLFTGLTHVQAQEVFRHPLGPQTTGAFRTTCSRLAEHPFIRGNFEQEKTLSRLNRSLKSSGNFIIAADLGMVWDTVAPFPSTLTLGRDFMIQSRPGGQKTVLSAQGNETFLRMAEVISTIFSGNAQGLLDNFTVYYSDNGDTLAWEMGLSPLDTAIHSFVQKIVMQGDTAIRSIHLYEQNGDSIKYLLSNHRYPAELNAHEKAFFSYP*
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
70.8%
Unclassified
16.7%
Termopsidae
8.3%
Kalotermitidae
4.2%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11736543 | 3300010049 | Bacteria | 775 |
| 2 | Ga0466712_056543 | 3300042614 | Bacteria | 8494 |
| 3 | Ga0466718_121215 | 3300042617 | Bacteria | 1610 |
| 4 | Ga0466720_013008 | 3300042607 | Bacteria | 7776 |
| 5 | Ga0466720_025415 | 3300042607 | Bacteria | 22188 |
| 6 | Ga0466720_045187 | 3300042607 | Bacteria | 27687 |
| 7 | Ga0466698_120996 | 3300042610 | Bacteria | 1160 |
| 8 | Ga0264413_101697 | 3300024493 | Bacteria | 51877 |
| 9 | Ga0415639_191219 | 3300038395 | Bacteria | 3819 |
| 10 | Ga0466699_173650 | 3300042597 | Bacteria | 20003 |
| 11 | JGI24698J34947_10000252 | 3300002449 | Bacteria | 22585 |
| 12 | JGI24698J34947_10000543 | 3300002449 | Bacteria | 17884 |
| 13 | JGI24698J34947_10024841 | 3300002449 | Bacteria | 3195 |
| 14 | JGI24698J34947_10031437 | 3300002449 | Bacteria | 2794 |
| 15 | JGI24696J40584_12734523 | 3300002834 | Bacteria | 774 |
| 16 | Ga0072941_1047673 | 3300005201 | Bacteria | 12730 |
| 17 | Ga0072941_1069009 | 3300005201 | Bacteria | 2089 |
| 18 | Ga0123356_10847616 | 3300010049 | Bacteria | 1085 |
| 19 | Ga0123353_10512501 | 3300010167 | Bacteria | 1743 |
| 20 | Ga0466718_150315 | 3300042617 | Bacteria | 9710 |
| 21 | Ga0466720_062453 | 3300042607 | Bacteria | 49933 |
| 22 | Ga0466720_114671 | 3300042607 | Bacteria | 1728 |
| 23 | Ga0466720_237680 | 3300042607 | Bacteria | 1483 |
| 24 | Ga0264413_143196 | 3300024493 | Bacteria | 2767 |
| 25 | JGI24698J34947_10107725 | 3300002449 | Bacteria | 1237 |
| 26 | JGI24695J34938_10016541 | 3300002450 | Bacteria | 3747 |
| 27 | Ga0466727_099740 | 3300042655 | Bacteria | 1359 |
| 28 | Ga0466712_033233 | 3300042614 | Bacteria | 2630 |
| 29 | Ga0466712_301016 | 3300042614 | Bacteria | 3876 |
| 30 | Ga0466712_314435 | 3300042614 | Bacteria | 1487 |
| 31 | Ga0466718_093367 | 3300042617 | Bacteria | 14318 |
| 32 | Ga0466718_101301 | 3300042617 | Bacteria | 4731 |
| 33 | Ga0466720_011334 | 3300042607 | Bacteria | 4727 |
| 34 | Ga0466698_227721 | 3300042610 | Bacteria | 2032 |
| 35 | Ga0264413_102618 | 3300024493 | Bacteria | 14484 |
| 36 | Ga0415639_018938 | 3300038395 | Unclassified | 10303 |
| 37 | Ga0466693_084880 | 3300042592 | Bacteria | 27365 |
| 38 | AustNasuHG_c1000146 | 3300000089 | Bacteria | 22298 |
| 39 | JGI24698J34947_10013009 | 3300002449 | Bacteria | 4546 |
| 40 | JGI24698J34947_10065352 | 3300002449 | Bacteria | 1774 |
| 41 | JGI24698J34947_10123757 | 3300002449 | Bacteria | 1118 |
| 42 | JGI24695J34938_10002227 | 3300002450 | Bacteria | 15057 |
| 43 | JGI24695J34938_10003390 | 3300002450 | Bacteria | 11181 |
| 44 | Ga0072941_1036251 | 3300005201 | Bacteria | 2286 |
| 45 | Ga0072941_1086477 | 3300005201 | Unclassified | 1746 |
| 46 | Ga0072941_1167414 | 3300005201 | Bacteria | 1621 |
| 47 | Ga0466731_131971 | 3300042622 | Bacteria | 1075 |
| 48 | Ga0466732_332208 | 3300042656 | Bacteria | 4215 |
| 49 | Ga0123355_10535576 | 3300009826 | Bacteria | 1424 |
| 50 | Ga0123353_10532112 | 3300010167 | Bacteria | 1701 |
| 51 | Ga0466712_004902 | 3300042614 | Bacteria | 2271 |
| 52 | Ga0466712_007985 | 3300042614 | Bacteria | 81055 |
| 53 | Ga0466712_175017 | 3300042614 | Bacteria | 45826 |
| 54 | Ga0466719_505776 | 3300042606 | Bacteria | 7854 |
| 55 | Ga0466720_085012 | 3300042607 | Bacteria | 10748 |
| 56 | Ga0466698_163266 | 3300042610 | Bacteria | 1068 |
| 57 | Ga0264413_142108 | 3300024493 | Bacteria | 2327 |
| 58 | JGI24695J34938_10000301 | 3300002450 | Bacteria | 48723 |
| 59 | JGI24695J34938_10068613 | 3300002450 | Bacteria | 1488 |
| 60 | JGI24695J34938_10092640 | 3300002450 | Bacteria | 1239 |
| 61 | Ga0466732_135099 | 3300042656 | Bacteria | 17004 |
| 62 | Ga0466732_331212 | 3300042656 | Bacteria | 1099 |
| 63 | Ga0466718_082424 | 3300042617 | Unclassified | 8125 |
| 64 | Ga0264413_104435 | 3300024493 | Bacteria | 6161 |
| 65 | Ga0264413_107804 | 3300024493 | Bacteria | 18094 |
| 66 | JGI24698J34947_10008776 | 3300002449 | Bacteria | 5544 |
| 67 | JGI24698J34947_10036820 | 3300002449 | Bacteria | 2545 |
| 68 | Ga0072941_1001332 | 3300005201 | Bacteria | 51552 |
| 69 | Ga0072941_1036250 | 3300005201 | Bacteria | 2120 |
| 70 | Ga0072941_1039612 | 3300005201 | Bacteria | 8566 |
| 71 | Ga0072941_1067465 | 3300005201 | Bacteria | 7411 |
| 72 | Ga0072941_1117892 | 3300005201 | Unclassified | 1632 |
| 73 | Ga0466712_022875 | 3300042614 | Bacteria | 13515 |
| 74 | Ga0466712_047601 | 3300042614 | Bacteria | 13819 |
| 75 | Ga0466712_124351 | 3300042614 | Bacteria | 6208 |
| 76 | Ga0466718_050523 | 3300042617 | Bacteria | 2441 |
| 77 | Ga0466707_309111 | 3300042601 | Bacteria | 3189 |
| 78 | Ga0466720_177334 | 3300042607 | Bacteria | 4639 |
| 79 | Ga0264413_138429 | 3300024493 | Bacteria | 4133 |
| 80 | Ga0466699_178162 | 3300042597 | Bacteria | 26425 |
| 81 | JGI24698J34947_10020044 | 3300002449 | Bacteria | 3604 |
| 82 | JGI24695J34938_10000021 | 3300002450 | Bacteria | 112419 |
| 83 | Ga0072941_1000456 | 3300005201 | Bacteria | 20789 |
| 84 | Ga0466712_139706 | 3300042614 | Bacteria | 19549 |
| 85 | Ga0466718_037202 | 3300042617 | Bacteria | 1573 |
| 86 | Ga0264413_104436 | 3300024493 | Bacteria | 4839 |
| 87 | Ga0466693_008875 | 3300042592 | Bacteria | 1394 |
| 88 | JGI24698J34947_10021998 | 3300002449 | Bacteria | 3423 |
| 89 | JGI24698J34947_10041267 | 3300002449 | Bacteria | 2377 |
| 90 | JGI24695J34938_10039017 | 3300002450 | Bacteria | 2148 |
| 91 | Ga0072941_1039610 | 3300005201 | Bacteria | 4724 |
| 92 | Ga0466735_063307 | 3300042624 | Bacteria | 14234 |
| 93 | Ga0466732_119354 | 3300042656 | Bacteria | 1159 |
| 94 | Ga0466732_262374 | 3300042656 | Bacteria | 16043 |
| 95 | Ga0123356_10000369 | 3300010049 | Bacteria | 51376 |
| 96 | Ga0466712_007941 | 3300042614 | Bacteria | 3111 |
| 97 | Ga0466712_114401 | 3300042614 | Bacteria | 32646 |
| 98 | Ga0466712_155246 | 3300042614 | Bacteria | 33581 |
| 99 | Ga0466718_163757 | 3300042617 | Bacteria | 3220 |
| 100 | Ga0466720_072686 | 3300042607 | Bacteria | 20088 |
| 101 | Ga0264413_117413 | 3300024493 | Bacteria | 6906 |
| 102 | Ga0466695_097075 | 3300042595 | Bacteria | 6093 |
| 103 | JGI24698J34947_10010343 | 3300002449 | Bacteria | 5116 |
| 104 | JGI24698J34947_10034194 | 3300002449 | Bacteria | 2662 |
| 105 | JGI24698J34947_10047092 | 3300002449 | Unclassified | 2190 |
| 106 | JGI24695J34938_10000611 | 3300002450 | Bacteria | 34277 |
| 107 | JGI24695J34938_10002079 | 3300002450 | Bacteria | 15713 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19574 | LolA_3 | Outer membrane lipoprotein carrier protein LolA-like | 75 | 231 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.