Protein Family IF00480
Metagenome
Isolate
121
Members
28
Samples
113
Scaffolds
739.17
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10003430|JGI24698J34947_100034303
- Length
- 763 aa
- Sequence
- MADKKKKTEKTKYLKIANFFSVAMVVFLSGAFIIEIMLGDSTVNNSFVALIMIITFFVVISIIRNTRNYYKXAFNVPFVLFLFYTXLMMSSKWVTPHYFLVCLSFCAISCIYSSYNRTIAFILAQNIVIGLLILRGAPVAGQNASFVVVLVNWVICLLGSLILLLITRSATVALSKALEHQLSFGNLLATTENYFAMIDEQNKVVYASKTLAQLGDVEDHTFVQGRPLIDLFPGRSLKIYAGKMIKEKDLYAEDWEFSLNGQKRYFKAASHSLPGNTGGSLISLYDMTHLAERDEIAAMKDSMKIGLFFMDQNFVIQDHYSKYLEEMLSESGLFGKLFTDIIADSVTPNELGIIKDYFGMVFARSYDQEMLDDINPLNELRYVNARTGDIKVFQFAFATVEKSHDEVYLLVTVYDITARVELQQKLAEEESKRQEEMQAVFELIQVQPDVFSDFMQDMEFEFGSIDKTLKNDTMSSHDALVKIYQSVHAIKSNAVILGLNIFGNKVHNLEAKIKKLREQEGDIPFVEMLNLTMDIEKISQEREGFKEIIKKLRSYAGSSGSGTGEKQNVKVLLESLSKTTSRVAEDLQKQVQFVATDIDSEAIDKGPRRTMKEILMQLIRNSVVHGVETPDVRKEKGKNETGTVKLSITMTEDHKTINMKLSDDGHGLDYKRIAEKAIQNKIIKKEDAGNKDMLIKAIFAPGFSTAETETVHGGRGIGLNLVRDRIKEINGNIKLRSEPDKGTVFFVTIPIAENPPAAKAEK*
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
69.2%
Unclassified
30.8%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
1
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 11 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 12 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 13 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_149357 | 3300042656 | Bacteria | 4607 |
| 2 | Ga0264413_127210 | 3300024493 | Bacteria | 3966 |
| 3 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 4 | Ga0466694_107653 | 3300042594 | Bacteria | 20211 |
| 5 | Ga0466712_212335 | 3300042614 | Bacteria | 23244 |
| 6 | Ga0466718_084557 | 3300042617 | Bacteria | 10224 |
| 7 | Ga0466720_021133 | 3300042607 | Unclassified | 11357 |
| 8 | Ga0466720_067705 | 3300042607 | Bacteria | 18756 |
| 9 | Ga0466731_144751 | 3300042622 | Bacteria | 3247 |
| 10 | Ga0466702_357657 | 3300042635 | Bacteria | 6079 |
| 11 | JGI24698J34947_10000302 | 3300002449 | Bacteria | 21573 |
| 12 | JGI24698J34947_10004243 | 3300002449 | Bacteria | 7792 |
| 13 | Ga0072940_1011858 | 3300005200 | Bacteria | 4418 |
| 14 | Ga0072940_1012345 | 3300005200 | Bacteria | 7973 |
| 15 | Ga0072941_1002406 | 3300005201 | Bacteria | 8360 |
| 16 | Ga0072941_1009598 | 3300005201 | Unclassified | 30689 |
| 17 | Ga0415639_137253 | 3300038395 | Bacteria | 3062 |
| 18 | Ga0466694_071769 | 3300042594 | Bacteria | 10143 |
| 19 | Ga0466712_005899 | 3300042614 | Bacteria | 24210 |
| 20 | Ga0466712_030734 | 3300042614 | Bacteria | 33065 |
| 21 | Ga0466720_173037 | 3300042607 | Bacteria | 2816 |
| 22 | Ga0466731_410645 | 3300042622 | Bacteria | 10338 |
| 23 | JGI24698J34947_10000221 | 3300002449 | Bacteria | 23579 |
| 24 | JGI24698J34947_10006185 | 3300002449 | Bacteria | 6575 |
| 25 | JGI24695J34938_10001401 | 3300002450 | Bacteria | 20606 |
| 26 | Ga0072941_1031170 | 3300005201 | Bacteria | 7740 |
| 27 | Ga0072941_1129471 | 3300005201 | Bacteria | 4904 |
| 28 | Ga0123356_10102369 | 3300010049 | Bacteria | 2749 |
| 29 | Ga0466712_104351 | 3300042614 | Bacteria | 15433 |
| 30 | Ga0466718_003118 | 3300042617 | Bacteria | 24685 |
| 31 | Ga0466718_031711 | 3300042617 | Bacteria | 7587 |
| 32 | Ga0466720_011340 | 3300042607 | Bacteria | 9787 |
| 33 | Ga0466702_218849 | 3300042635 | Bacteria | 15051 |
| 34 | JGI24695J34938_10000690 | 3300002450 | Bacteria | 31868 |
| 35 | Ga0072940_1011860 | 3300005200 | Bacteria | 4617 |
| 36 | Ga0072941_1027502 | 3300005201 | Bacteria | 4654 |
| 37 | Ga0123356_10000532 | 3300010049 | Bacteria | 42369 |
| 38 | Ga0123356_10000903 | 3300010049 | Bacteria | 32829 |
| 39 | Ga0466699_046007 | 3300042597 | Bacteria | 5692 |
| 40 | Ga0466699_243244 | 3300042597 | Bacteria | 7863 |
| 41 | Ga0466718_053091 | 3300042617 | Bacteria | 27643 |
| 42 | Ga0466718_056483 | 3300042617 | Bacteria | 7498 |
| 43 | Ga0466718_071232 | 3300042617 | Bacteria | 5686 |
| 44 | Ga0466718_109220 | 3300042617 | Bacteria | 21117 |
| 45 | Ga0466718_118076 | 3300042617 | Bacteria | 20033 |
| 46 | Ga0466720_073471 | 3300042607 | Bacteria | 8265 |
| 47 | Ga0466720_137070 | 3300042607 | Bacteria | 34404 |
| 48 | AustNasuHG_c1000066 | 3300000089 | Bacteria | 28642 |
| 49 | AustNasuHG_c1001324 | 3300000089 | Bacteria | 8872 |
| 50 | JGI24698J34947_10003271 | 3300002449 | Bacteria | 8781 |
| 51 | JGI24698J34947_10013224 | 3300002449 | Bacteria | 4509 |
| 52 | JGI24695J34938_10006349 | 3300002450 | Bacteria | 7135 |
| 53 | Ga0072940_1030110 | 3300005200 | Bacteria | 16965 |
| 54 | Ga0123355_10100598 | 3300009826 | Bacteria | 4553 |
| 55 | Ga0466732_107716 | 3300042656 | Bacteria | 13918 |
| 56 | Ga0466732_254777 | 3300042656 | Bacteria | 8542 |
| 57 | Ga0466732_419393 | 3300042656 | Bacteria | 6511 |
| 58 | Ga0264413_101823 | 3300024493 | Bacteria | 18008 |
| 59 | Ga0264413_101954 | 3300024493 | Bacteria | 12284 |
| 60 | Ga0264413_133789 | 3300024493 | Bacteria | 3326 |
| 61 | Ga0466712_079378 | 3300042614 | Bacteria | 31085 |
| 62 | Ga0466720_165433 | 3300042607 | Bacteria | 11572 |
| 63 | Ga0466702_113618 | 3300042635 | Bacteria | 13678 |
| 64 | JGI24698J34947_10003430 | 3300002449 | Bacteria | 8604 |
| 65 | JGI24698J34947_10024744 | 3300002449 | Unclassified | 3202 |
| 66 | JGI24695J34938_10000220 | 3300002450 | Bacteria | 54504 |
| 67 | JGI24695J34938_10001084 | 3300002450 | Bacteria | 24598 |
| 68 | JGI24695J34938_10004729 | 3300002450 | Bacteria | 8814 |
| 69 | JGI24695J34938_10009136 | 3300002450 | Bacteria | 5543 |
| 70 | Ga0072941_1015354 | 3300005201 | Bacteria | 6705 |
| 71 | Ga0072941_1090115 | 3300005201 | Bacteria | 13891 |
| 72 | Ga0123356_10000073 | 3300010049 | Bacteria | 106706 |
| 73 | Ga0123356_10000245 | 3300010049 | Bacteria | 62546 |
| 74 | Ga0264413_107518 | 3300024493 | Bacteria | 40797 |
| 75 | Ga0415639_024531 | 3300038395 | Bacteria | 8051 |
| 76 | Ga0466712_293443 | 3300042614 | Bacteria | 21258 |
| 77 | Ga0466718_052337 | 3300042617 | Bacteria | 7631 |
| 78 | Ga0466718_120960 | 3300042617 | Bacteria | 25321 |
| 79 | Ga0466720_109497 | 3300042607 | Bacteria | 28074 |
| 80 | Ga0466698_015343 | 3300042610 | Bacteria | 5923 |
| 81 | AustNasuHG_c1004867 | 3300000089 | Bacteria | 4808 |
| 82 | JGI24698J34947_10006323 | 3300002449 | Bacteria | 6507 |
| 83 | JGI24695J34938_10000208 | 3300002450 | Bacteria | 55819 |
| 84 | JGI24695J34938_10004718 | 3300002450 | Bacteria | 8822 |
| 85 | JGI24695J34938_10005116 | 3300002450 | Unclassified | 8314 |
| 86 | Ga0072941_1036525 | 3300005201 | Bacteria | 6639 |
| 87 | Ga0264413_101952 | 3300024493 | Bacteria | 4084 |
| 88 | Ga0466693_073539 | 3300042592 | Bacteria | 32181 |
| 89 | Ga0466694_042514 | 3300042594 | Bacteria | 25116 |
| 90 | Ga0466699_026831 | 3300042597 | Bacteria | 36485 |
| 91 | Ga0466712_022882 | 3300042614 | Bacteria | 8798 |
| 92 | Ga0466718_029165 | 3300042617 | Viruses | 5967 |
| 93 | Ga0466720_214570 | 3300042607 | Bacteria | 8382 |
| 94 | Ga0466721_220378 | 3300042608 | Bacteria | 49670 |
| 95 | Ga0466702_372942 | 3300042635 | Bacteria | 13191 |
| 96 | JGI24698J34947_10000452 | 3300002449 | Bacteria | 19069 |
| 97 | JGI24695J34938_10003017 | 3300002450 | Bacteria | 12101 |
| 98 | JGI24695J34938_10005110 | 3300002450 | Bacteria | 8321 |
| 99 | Ga0123356_10002549 | 3300010049 | Bacteria | 19464 |
| 100 | Ga0123356_10075768 | 3300010049 | Bacteria | 3169 |
| 101 | Ga0466732_101986 | 3300042656 | Bacteria | 25064 |
| 102 | Ga0264413_107351 | 3300024493 | Bacteria | 5856 |
| 103 | Ga0264413_107706 | 3300024493 | Bacteria | 7407 |
| 104 | Ga0415639_023622 | 3300038395 | Bacteria | 14881 |
| 105 | Ga0466694_269319 | 3300042594 | Bacteria | 12046 |
| 106 | Ga0466699_143611 | 3300042597 | Bacteria | 11418 |
| 107 | Ga0466712_075534 | 3300042614 | Bacteria | 3882 |
| 108 | Ga0466712_278027 | 3300042614 | Bacteria | 8416 |
| 109 | Ga0466718_008010 | 3300042617 | Unclassified | 7424 |
| 110 | Ga0466720_158503 | 3300042607 | Bacteria | 4063 |
| 111 | Ga0466698_084683 | 3300042610 | Bacteria | 17923 |
| 112 | Ga0466702_232177 | 3300042635 | Bacteria | 20538 |
| 113 | Ga0123356_10021612 | 3300010049 | Bacteria | 6073 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02518 | HATPase_c | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | 611 | 752 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.