Protein Family IF00282
Metagenome
Isolate
237
Members
70
Samples
214
Scaffolds
479
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1003430|AustNasuHG_10034305
- Length
- 483 aa
- Sequence
- MKNADIGLIGLAVMGENLVLNMESKGFQVAVYNRTTSKVDDFVKGRGAGKKITGCYNMAELAAALSRPRKVMIMVKAGQAVDDTIEQLIAVLEKGDIIIDGGNSNYQDTMRRTALVESKGLLYIGTGVSGGEEGALTGPSIMPGGSPSAWPEVKPILQAISAKVDGNIPCCDWVGENGAGHFVKMVHNGIEYGDMQLICETYDLMKNVLGLSDDEMSNVFDEWNKGSLGSYLIEITRDILRYKDEDGKPLVEKILDTAGQKGTGKWTGIAALEFGVPLTLIGEAVFGRCLSAAKDERLRAAKVFSGPKAVQTDKAAFIKDLEKALYASKLVSYAQGYLLMREAAGEYKWNLNYGGIALLWRGGCIIRSVFLGKIKEAFDKKPDLENLLLDPFFAGVIAEAQAPWRRVVTAAVQSGVPVPAFSSALAYFDGYRSERLPANLLQAQRDYFGAHTYERTDKKRGEFFHTNWTGHGGTTSASTYTV*
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.3%
Termitidae
32.4%
Kalotermitidae
20.6%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Hodotermitidae
1.5%
Armadillidiidae
1.5%
Taxonomy
Archaea
0
Bacteria
226
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 8 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 22 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 23 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 29 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 30 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 37 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 44 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 45 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 46 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 47 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 50 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 51 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 52 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 58 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 59 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 64 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 65 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 66 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_103765 | 3300024493 | Bacteria | 6825 |
| 2 | Ga0466691_215600 | 3300042593 | Bacteria | 5965 |
| 3 | Ga0466694_402768 | 3300042594 | Bacteria | 1628 |
| 4 | Ga0466699_170536 | 3300042597 | Bacteria | 6505 |
| 5 | Ga0123356_10028803 | 3300010049 | Bacteria | 5205 |
| 6 | Ga0123356_10045632 | 3300010049 | Bacteria | 4077 |
| 7 | Ga0123353_10116063 | 3300010167 | Bacteria | 4308 |
| 8 | Ga0123354_10114778 | 3300010882 | Bacteria | 3526 |
| 9 | JGI24698J34947_10011393 | 3300002449 | Bacteria | 4883 |
| 10 | JGI24695J34938_10002350 | 3300002450 | Bacteria | 14566 |
| 11 | JGI24695J34938_10020224 | 3300002450 | Bacteria | 3280 |
| 12 | Ga0466712_012241 | 3300042614 | Bacteria | 49075 |
| 13 | Ga0466712_038683 | 3300042614 | Bacteria | 9270 |
| 14 | Ga0466711_353289 | 3300042615 | Bacteria | 9121 |
| 15 | Ga0466715_105586 | 3300042616 | Bacteria | 17333 |
| 16 | Ga0466715_343380 | 3300042616 | Bacteria | 27391 |
| 17 | Ga0466715_576520 | 3300042616 | Bacteria | 6975 |
| 18 | Ga0466726_372012 | 3300042619 | Bacteria | 3206 |
| 19 | Ga0466694_039362 | 3300042594 | Bacteria | 53982 |
| 20 | Ga0466694_334975 | 3300042594 | Bacteria | 6999 |
| 21 | Ga0466696_203318 | 3300042596 | Bacteria | 16214 |
| 22 | Ga0466719_026957 | 3300042606 | Bacteria | 5189 |
| 23 | Ga0466722_128331 | 3300042609 | Bacteria | 6645 |
| 24 | Ga0466722_139043 | 3300042609 | Bacteria | 3058 |
| 25 | Ga0123356_10000078 | 3300010049 | Bacteria | 103379 |
| 26 | Ga0466703_321048 | 3300042636 | Bacteria | 44056 |
| 27 | Ga0466704_082107 | 3300042643 | Bacteria | 6740 |
| 28 | Ga0466709_076303 | 3300042648 | Bacteria | 14469 |
| 29 | Ga0466708_430879 | 3300042652 | Unclassified | 2565 |
| 30 | Ga0466727_172960 | 3300042655 | Bacteria | 16116 |
| 31 | JGI24698J34947_10019371 | 3300002449 | Bacteria | 3670 |
| 32 | JGI24695J34938_10000734 | 3300002450 | Bacteria | 30892 |
| 33 | JGI24702J35022_10001861 | 3300002462 | Bacteria | 12986 |
| 34 | Ga0466712_088038 | 3300042614 | Bacteria | 15303 |
| 35 | Ga0466726_243710 | 3300042619 | Bacteria | 2816 |
| 36 | Ga0466726_257323 | 3300042619 | Bacteria | 2313 |
| 37 | Ga0466705_164747 | 3300042612 | Bacteria | 7292 |
| 38 | Ga0415639_041351 | 3300038395 | Bacteria | 12114 |
| 39 | Ga0466690_018956 | 3300042590 | Bacteria | 5302 |
| 40 | Ga0466690_118623 | 3300042590 | Unclassified | 4414 |
| 41 | Ga0466690_149179 | 3300042590 | Bacteria | 9626 |
| 42 | Ga0466694_024239 | 3300042594 | Bacteria | 14266 |
| 43 | Ga0466694_106808 | 3300042594 | Bacteria | 82814 |
| 44 | Ga0466694_165579 | 3300042594 | Bacteria | 1658 |
| 45 | Ga0466696_316981 | 3300042596 | Bacteria | 21745 |
| 46 | Ga0466721_281157 | 3300042608 | Bacteria | 2271 |
| 47 | Ga0123353_10433911 | 3300010167 | Bacteria | 1941 |
| 48 | Ga0466703_065868 | 3300042636 | Bacteria | 21346 |
| 49 | Ga0466708_269631 | 3300042652 | Bacteria | 3049 |
| 50 | Ga0466727_312861 | 3300042655 | Bacteria | 2473 |
| 51 | AustNasuHG_c1006349 | 3300000089 | Bacteria | 4224 |
| 52 | JGI24698J34947_10001028 | 3300002449 | Bacteria | 14368 |
| 53 | JGI24698J34947_10054642 | 3300002449 | Bacteria | 1993 |
| 54 | JGI24695J34938_10000015 | 3300002450 | Bacteria | 118711 |
| 55 | JGI24695J34938_10000448 | 3300002450 | Bacteria | 39903 |
| 56 | JGI24695J34938_10001317 | 3300002450 | Bacteria | 21601 |
| 57 | JGI24695J34938_10007165 | 3300002450 | Bacteria | 6578 |
| 58 | JGI24695J34938_10007452 | 3300002450 | Bacteria | 6402 |
| 59 | JGI24695J34938_10026180 | 3300002450 | Unclassified | 2775 |
| 60 | JGI24695J34938_10047338 | 3300002450 | Bacteria | 1899 |
| 61 | JGI24702J35022_10007399 | 3300002462 | Bacteria | 6295 |
| 62 | Ga0466712_106547 | 3300042614 | Bacteria | 2841 |
| 63 | Ga0466715_150819 | 3300042616 | Bacteria | 7328 |
| 64 | Ga0466715_223994 | 3300042616 | Bacteria | 12835 |
| 65 | Ga0466723_034353 | 3300042618 | Bacteria | 2554 |
| 66 | Ga0466723_161549 | 3300042618 | Bacteria | 19612 |
| 67 | Ga0466729_141750 | 3300042621 | Bacteria | 2996 |
| 68 | Ga0466705_037399 | 3300042612 | Bacteria | 27257 |
| 69 | Ga0264413_102686 | 3300024493 | Bacteria | 33341 |
| 70 | Ga0466691_089028 | 3300042593 | Bacteria | 39976 |
| 71 | Ga0466694_192169 | 3300042594 | Bacteria | 16895 |
| 72 | Ga0466694_231254 | 3300042594 | Bacteria | 7952 |
| 73 | Ga0466699_037059 | 3300042597 | Bacteria | 1686 |
| 74 | Ga0466699_169008 | 3300042597 | Bacteria | 25209 |
| 75 | Ga0466707_287490 | 3300042601 | Bacteria | 3071 |
| 76 | Ga0466722_239481 | 3300042609 | Bacteria | 17575 |
| 77 | Ga0466698_407871 | 3300042610 | Bacteria | 6428 |
| 78 | Ga0123356_10149386 | 3300010049 | Bacteria | 2317 |
| 79 | Ga0123354_10033558 | 3300010882 | Bacteria | 8033 |
| 80 | Ga0466735_111076 | 3300042624 | Bacteria | 10783 |
| 81 | Ga0466703_019518 | 3300042636 | Bacteria | 5887 |
| 82 | Ga0466704_179992 | 3300042643 | Bacteria | 35247 |
| 83 | JGI24698J34947_10008838 | 3300002449 | Unclassified | 5529 |
| 84 | JGI24698J34947_10010187 | 3300002449 | Bacteria | 5154 |
| 85 | JGI24698J34947_10016492 | 3300002449 | Bacteria | 4010 |
| 86 | JGI24695J34938_10000184 | 3300002450 | Bacteria | 58384 |
| 87 | JGI24695J34938_10002656 | 3300002450 | Bacteria | 13332 |
| 88 | JGI24695J34938_10003393 | 3300002450 | Bacteria | 11176 |
| 89 | JGI24695J34938_10003563 | 3300002450 | Bacteria | 10737 |
| 90 | JGI24695J34938_10008781 | 3300002450 | Bacteria | 5723 |
| 91 | JGI24695J34938_10033144 | 3300002450 | Bacteria | 2379 |
| 92 | Ga0072941_1003165 | 3300005201 | Bacteria | 19020 |
| 93 | Ga0072941_1008304 | 3300005201 | Bacteria | 11323 |
| 94 | Ga0466711_247066 | 3300042615 | Bacteria | 3299 |
| 95 | Ga0466715_313282 | 3300042616 | Bacteria | 6806 |
| 96 | Ga0466718_076820 | 3300042617 | Bacteria | 5703 |
| 97 | Ga0466718_096618 | 3300042617 | Bacteria | 19732 |
| 98 | Ga0466726_189386 | 3300042619 | Bacteria | 8848 |
| 99 | Ga0466726_319007 | 3300042619 | Bacteria | 2012 |
| 100 | Ga0466691_053455 | 3300042593 | Bacteria | 31332 |
| 101 | Ga0466691_141739 | 3300042593 | Bacteria | 11905 |
| 102 | Ga0466694_018450 | 3300042594 | Bacteria | 43707 |
| 103 | Ga0466706_233745 | 3300042599 | Bacteria | 2642 |
| 104 | Ga0466707_100110 | 3300042601 | Bacteria | 11409 |
| 105 | Ga0466707_395196 | 3300042601 | Bacteria | 1737 |
| 106 | Ga0466719_372721 | 3300042606 | Unclassified | 2870 |
| 107 | Ga0466719_390717 | 3300042606 | Bacteria | 6475 |
| 108 | Ga0466722_026032 | 3300042609 | Bacteria | 2759 |
| 109 | Ga0466722_040501 | 3300042609 | Bacteria | 13194 |
| 110 | Ga0466722_266254 | 3300042609 | Bacteria | 1853 |
| 111 | Ga0123356_10000124 | 3300010049 | Bacteria | 85126 |
| 112 | Ga0123356_10002113 | 3300010049 | Bacteria | 21429 |
| 113 | Ga0123356_10014935 | 3300010049 | Unclassified | 7450 |
| 114 | Ga0466731_360324 | 3300042622 | Bacteria | 23256 |
| 115 | Ga0466709_253354 | 3300042648 | Bacteria | 19722 |
| 116 | AustNasuHG_c1003430 | 3300000089 | Bacteria | 5719 |
| 117 | AustNasuHG_c1007562 | 3300000089 | Bacteria | 3858 |
| 118 | JGI24698J34947_10014819 | 3300002449 | Bacteria | 4245 |
| 119 | JGI24695J34938_10012428 | 3300002450 | Bacteria | 4511 |
| 120 | JGI24695J34938_10012855 | 3300002450 | Bacteria | 4420 |
| 121 | Ga0466712_094954 | 3300042614 | Bacteria | 5978 |
| 122 | Ga0466712_306596 | 3300042614 | Bacteria | 2742 |
| 123 | Ga0466718_126693 | 3300042617 | Bacteria | 1873 |
| 124 | Ga0466726_407422 | 3300042619 | Bacteria | 3685 |
| 125 | Ga0466732_212305 | 3300042656 | Bacteria | 5148 |
| 126 | Ga0264413_104482 | 3300024493 | Bacteria | 4724 |
| 127 | Ga0466696_018386 | 3300042596 | Bacteria | 22730 |
| 128 | Ga0466696_504803 | 3300042596 | Bacteria | 23151 |
| 129 | Ga0466699_378204 | 3300042597 | Bacteria | 4457 |
| 130 | Ga0466716_052602 | 3300042605 | Bacteria | 5064 |
| 131 | Ga0466720_041917 | 3300042607 | Bacteria | 17187 |
| 132 | Ga0466722_238332 | 3300042609 | Bacteria | 2181 |
| 133 | Ga0123356_10000426 | 3300010049 | Bacteria | 48138 |
| 134 | Ga0466731_396239 | 3300042622 | Bacteria | 2126 |
| 135 | Ga0466703_139894 | 3300042636 | Bacteria | 7763 |
| 136 | Ga0466704_074771 | 3300042643 | Bacteria | 86016 |
| 137 | Ga0466704_466222 | 3300042643 | Bacteria | 45364 |
| 138 | Ga0466704_589010 | 3300042643 | Bacteria | 7072 |
| 139 | Ga0466709_160431 | 3300042648 | Bacteria | 3198 |
| 140 | AustNasuHG_c1001001 | 3300000089 | Bacteria | 10177 |
| 141 | JGI24695J34938_10000731 | 3300002450 | Bacteria | 30954 |
| 142 | JGI24695J34938_10004826 | 3300002450 | Bacteria | 8667 |
| 143 | JGI24695J34938_10007492 | 3300002450 | Bacteria | 6382 |
| 144 | Ga0466711_095440 | 3300042615 | Bacteria | 6276 |
| 145 | Ga0466715_270811 | 3300042616 | Bacteria | 16378 |
| 146 | Ga0466715_394356 | 3300042616 | Bacteria | 19584 |
| 147 | Ga0466718_033281 | 3300042617 | Bacteria | 35431 |
| 148 | Ga0466718_054025 | 3300042617 | Bacteria | 5992 |
| 149 | Ga0466726_174006 | 3300042619 | Bacteria | 13818 |
| 150 | Ga0466705_004176 | 3300042612 | Bacteria | 26037 |
| 151 | Ga0466705_079814 | 3300042612 | Bacteria | 11344 |
| 152 | Ga0466690_184614 | 3300042590 | Unclassified | 2727 |
| 153 | Ga0466690_352501 | 3300042590 | Unclassified | 5668 |
| 154 | Ga0466692_082619 | 3300042591 | Bacteria | 1906 |
| 155 | Ga0466692_086464 | 3300042591 | Bacteria | 23953 |
| 156 | Ga0466692_180850 | 3300042591 | Bacteria | 5241 |
| 157 | Ga0466694_077871 | 3300042594 | Bacteria | 71235 |
| 158 | Ga0466695_148876 | 3300042595 | Bacteria | 2216 |
| 159 | Ga0466699_337780 | 3300042597 | Bacteria | 7977 |
| 160 | Ga0466719_345398 | 3300042606 | Bacteria | 10216 |
| 161 | Ga0466719_422546 | 3300042606 | Bacteria | 38458 |
| 162 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 163 | Ga0466722_009326 | 3300042609 | Bacteria | 7148 |
| 164 | Ga0123356_10000576 | 3300010049 | Bacteria | 40790 |
| 165 | Ga0466704_060382 | 3300042643 | Bacteria | 33102 |
| 166 | Ga0466704_090220 | 3300042643 | Bacteria | 6410 |
| 167 | Ga0466708_017438 | 3300042652 | Bacteria | 2631 |
| 168 | AustNasuHG_c1008190 | 3300000089 | Bacteria | 3706 |
| 169 | JGI24698J34947_10013500 | 3300002449 | Bacteria | 4459 |
| 170 | JGI24698J34947_10018513 | 3300002449 | Bacteria | 3761 |
| 171 | JGI24702J35022_10089537 | 3300002462 | Bacteria | 1673 |
| 172 | JGI24700J35501_10911089 | 3300002508 | Bacteria | 3584 |
| 173 | Ga0072941_1008303 | 3300005201 | Bacteria | 14100 |
| 174 | Ga0123357_10001858 | 3300009784 | Bacteria | 22927 |
| 175 | Ga0466705_436006 | 3300042612 | Bacteria | 2138 |
| 176 | Ga0466715_000194 | 3300042616 | Bacteria | 5288 |
| 177 | Ga0466715_364165 | 3300042616 | Bacteria | 16347 |
| 178 | Ga0466723_052961 | 3300042618 | Bacteria | 34600 |
| 179 | Ga0466723_110384 | 3300042618 | Bacteria | 1932 |
| 180 | Ga0466726_102249 | 3300042619 | Bacteria | 2593 |
| 181 | Ga0466705_131848 | 3300042612 | Bacteria | 6345 |
| 182 | Ga0466705_145124 | 3300042612 | Unclassified | 16840 |
| 183 | Ga0160443_100063 | 3300012848 | Bacteria | 208537 |
| 184 | Ga0415639_041352 | 3300038395 | Bacteria | 1783 |
| 185 | Ga0466693_150660 | 3300042592 | Bacteria | 7821 |
| 186 | Ga0466691_073293 | 3300042593 | Bacteria | 27182 |
| 187 | Ga0466719_052414 | 3300042606 | Bacteria | 13658 |
| 188 | Ga0466719_119567 | 3300042606 | Bacteria | 21802 |
| 189 | Ga0466720_001519 | 3300042607 | Unclassified | 3094 |
| 190 | Ga0466720_225075 | 3300042607 | Bacteria | 3386 |
| 191 | Ga0466722_125896 | 3300042609 | Bacteria | 10612 |
| 192 | Ga0123353_10194097 | 3300010167 | Bacteria | 3202 |
| 193 | Ga0466702_434115 | 3300042635 | Bacteria | 4958 |
| 194 | Ga0466703_257974 | 3300042636 | Bacteria | 4493 |
| 195 | Ga0466704_053627 | 3300042643 | Bacteria | 2530 |
| 196 | Ga0466704_433254 | 3300042643 | Bacteria | 10543 |
| 197 | Ga0466708_452772 | 3300042652 | Bacteria | 4869 |
| 198 | Ga0466727_256235 | 3300042655 | Bacteria | 2423 |
| 199 | JGI24698J34947_10019510 | 3300002449 | Unclassified | 3657 |
| 200 | JGI24695J34938_10000011 | 3300002450 | Bacteria | 126968 |
| 201 | JGI24695J34938_10000168 | 3300002450 | Bacteria | 61343 |
| 202 | JGI24695J34938_10000430 | 3300002450 | Bacteria | 40506 |
| 203 | JGI24695J34938_10031169 | 3300002450 | Bacteria | 2477 |
| 204 | Ga0466712_148528 | 3300042614 | Bacteria | 5793 |
| 205 | Ga0466718_084956 | 3300042617 | Bacteria | 13819 |
| 206 | Ga0466723_015663 | 3300042618 | Bacteria | 58778 |
| 207 | Ga0466723_036632 | 3300042618 | Bacteria | 1733 |
| 208 | Ga0466723_076742 | 3300042618 | Bacteria | 9218 |
| 209 | Ga0466723_199441 | 3300042618 | Bacteria | 13060 |
| 210 | Ga0466726_100500 | 3300042619 | Bacteria | 8675 |
| 211 | Ga0466728_151120 | 3300042620 | Bacteria | 7251 |
| 212 | Ga0466728_153866 | 3300042620 | Bacteria | 11970 |
| 213 | Ga0466728_306601 | 3300042620 | Bacteria | 6189 |
| 214 | Ga0466728_460598 | 3300042620 | Bacteria | 6412 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03446 | GO:0050661 | NADP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.