Protein Family IF00282

Metagenome Isolate
237 Members
70 Samples
214 Scaffolds
479 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1003430|AustNasuHG_10034305
Length
483 aa
Sequence
MKNADIGLIGLAVMGENLVLNMESKGFQVAVYNRTTSKVDDFVKGRGAGKKITGCYNMAELAAALSRPRKVMIMVKAGQAVDDTIEQLIAVLEKGDIIIDGGNSNYQDTMRRTALVESKGLLYIGTGVSGGEEGALTGPSIMPGGSPSAWPEVKPILQAISAKVDGNIPCCDWVGENGAGHFVKMVHNGIEYGDMQLICETYDLMKNVLGLSDDEMSNVFDEWNKGSLGSYLIEITRDILRYKDEDGKPLVEKILDTAGQKGTGKWTGIAALEFGVPLTLIGEAVFGRCLSAAKDERLRAAKVFSGPKAVQTDKAAFIKDLEKALYASKLVSYAQGYLLMREAAGEYKWNLNYGGIALLWRGGCIIRSVFLGKIKEAFDKKPDLENLLLDPFFAGVIAEAQAPWRRVVTAAVQSGVPVPAFSSALAYFDGYRSERLPANLLQAQRDYFGAHTYERTDKKRGEFFHTNWTGHGGTTSASTYTV*

πŸ“Š Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 35.3%
Termitidae 32.4%
Kalotermitidae 20.6%
Rhinotermitidae 4.4%
Termopsidae 4.4%
Hodotermitidae 1.5%
Armadillidiidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 226
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
8 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
22 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
23 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
29 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
30 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
37 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
44 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
45 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
46 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
47 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
50 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
51 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
52 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
53 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
54 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
58 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
59 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
62 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
65 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
66 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
69 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
70 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_103765 3300024493 Bacteria 6825
2 Ga0466691_215600 3300042593 Bacteria 5965
3 Ga0466694_402768 3300042594 Bacteria 1628
4 Ga0466699_170536 3300042597 Bacteria 6505
5 Ga0123356_10028803 3300010049 Bacteria 5205
6 Ga0123356_10045632 3300010049 Bacteria 4077
7 Ga0123353_10116063 3300010167 Bacteria 4308
8 Ga0123354_10114778 3300010882 Bacteria 3526
9 JGI24698J34947_10011393 3300002449 Bacteria 4883
10 JGI24695J34938_10002350 3300002450 Bacteria 14566
11 JGI24695J34938_10020224 3300002450 Bacteria 3280
12 Ga0466712_012241 3300042614 Bacteria 49075
13 Ga0466712_038683 3300042614 Bacteria 9270
14 Ga0466711_353289 3300042615 Bacteria 9121
15 Ga0466715_105586 3300042616 Bacteria 17333
16 Ga0466715_343380 3300042616 Bacteria 27391
17 Ga0466715_576520 3300042616 Bacteria 6975
18 Ga0466726_372012 3300042619 Bacteria 3206
19 Ga0466694_039362 3300042594 Bacteria 53982
20 Ga0466694_334975 3300042594 Bacteria 6999
21 Ga0466696_203318 3300042596 Bacteria 16214
22 Ga0466719_026957 3300042606 Bacteria 5189
23 Ga0466722_128331 3300042609 Bacteria 6645
24 Ga0466722_139043 3300042609 Bacteria 3058
25 Ga0123356_10000078 3300010049 Bacteria 103379
26 Ga0466703_321048 3300042636 Bacteria 44056
27 Ga0466704_082107 3300042643 Bacteria 6740
28 Ga0466709_076303 3300042648 Bacteria 14469
29 Ga0466708_430879 3300042652 Unclassified 2565
30 Ga0466727_172960 3300042655 Bacteria 16116
31 JGI24698J34947_10019371 3300002449 Bacteria 3670
32 JGI24695J34938_10000734 3300002450 Bacteria 30892
33 JGI24702J35022_10001861 3300002462 Bacteria 12986
34 Ga0466712_088038 3300042614 Bacteria 15303
35 Ga0466726_243710 3300042619 Bacteria 2816
36 Ga0466726_257323 3300042619 Bacteria 2313
37 Ga0466705_164747 3300042612 Bacteria 7292
38 Ga0415639_041351 3300038395 Bacteria 12114
39 Ga0466690_018956 3300042590 Bacteria 5302
40 Ga0466690_118623 3300042590 Unclassified 4414
41 Ga0466690_149179 3300042590 Bacteria 9626
42 Ga0466694_024239 3300042594 Bacteria 14266
43 Ga0466694_106808 3300042594 Bacteria 82814
44 Ga0466694_165579 3300042594 Bacteria 1658
45 Ga0466696_316981 3300042596 Bacteria 21745
46 Ga0466721_281157 3300042608 Bacteria 2271
47 Ga0123353_10433911 3300010167 Bacteria 1941
48 Ga0466703_065868 3300042636 Bacteria 21346
49 Ga0466708_269631 3300042652 Bacteria 3049
50 Ga0466727_312861 3300042655 Bacteria 2473
51 AustNasuHG_c1006349 3300000089 Bacteria 4224
52 JGI24698J34947_10001028 3300002449 Bacteria 14368
53 JGI24698J34947_10054642 3300002449 Bacteria 1993
54 JGI24695J34938_10000015 3300002450 Bacteria 118711
55 JGI24695J34938_10000448 3300002450 Bacteria 39903
56 JGI24695J34938_10001317 3300002450 Bacteria 21601
57 JGI24695J34938_10007165 3300002450 Bacteria 6578
58 JGI24695J34938_10007452 3300002450 Bacteria 6402
59 JGI24695J34938_10026180 3300002450 Unclassified 2775
60 JGI24695J34938_10047338 3300002450 Bacteria 1899
61 JGI24702J35022_10007399 3300002462 Bacteria 6295
62 Ga0466712_106547 3300042614 Bacteria 2841
63 Ga0466715_150819 3300042616 Bacteria 7328
64 Ga0466715_223994 3300042616 Bacteria 12835
65 Ga0466723_034353 3300042618 Bacteria 2554
66 Ga0466723_161549 3300042618 Bacteria 19612
67 Ga0466729_141750 3300042621 Bacteria 2996
68 Ga0466705_037399 3300042612 Bacteria 27257
69 Ga0264413_102686 3300024493 Bacteria 33341
70 Ga0466691_089028 3300042593 Bacteria 39976
71 Ga0466694_192169 3300042594 Bacteria 16895
72 Ga0466694_231254 3300042594 Bacteria 7952
73 Ga0466699_037059 3300042597 Bacteria 1686
74 Ga0466699_169008 3300042597 Bacteria 25209
75 Ga0466707_287490 3300042601 Bacteria 3071
76 Ga0466722_239481 3300042609 Bacteria 17575
77 Ga0466698_407871 3300042610 Bacteria 6428
78 Ga0123356_10149386 3300010049 Bacteria 2317
79 Ga0123354_10033558 3300010882 Bacteria 8033
80 Ga0466735_111076 3300042624 Bacteria 10783
81 Ga0466703_019518 3300042636 Bacteria 5887
82 Ga0466704_179992 3300042643 Bacteria 35247
83 JGI24698J34947_10008838 3300002449 Unclassified 5529
84 JGI24698J34947_10010187 3300002449 Bacteria 5154
85 JGI24698J34947_10016492 3300002449 Bacteria 4010
86 JGI24695J34938_10000184 3300002450 Bacteria 58384
87 JGI24695J34938_10002656 3300002450 Bacteria 13332
88 JGI24695J34938_10003393 3300002450 Bacteria 11176
89 JGI24695J34938_10003563 3300002450 Bacteria 10737
90 JGI24695J34938_10008781 3300002450 Bacteria 5723
91 JGI24695J34938_10033144 3300002450 Bacteria 2379
92 Ga0072941_1003165 3300005201 Bacteria 19020
93 Ga0072941_1008304 3300005201 Bacteria 11323
94 Ga0466711_247066 3300042615 Bacteria 3299
95 Ga0466715_313282 3300042616 Bacteria 6806
96 Ga0466718_076820 3300042617 Bacteria 5703
97 Ga0466718_096618 3300042617 Bacteria 19732
98 Ga0466726_189386 3300042619 Bacteria 8848
99 Ga0466726_319007 3300042619 Bacteria 2012
100 Ga0466691_053455 3300042593 Bacteria 31332
101 Ga0466691_141739 3300042593 Bacteria 11905
102 Ga0466694_018450 3300042594 Bacteria 43707
103 Ga0466706_233745 3300042599 Bacteria 2642
104 Ga0466707_100110 3300042601 Bacteria 11409
105 Ga0466707_395196 3300042601 Bacteria 1737
106 Ga0466719_372721 3300042606 Unclassified 2870
107 Ga0466719_390717 3300042606 Bacteria 6475
108 Ga0466722_026032 3300042609 Bacteria 2759
109 Ga0466722_040501 3300042609 Bacteria 13194
110 Ga0466722_266254 3300042609 Bacteria 1853
111 Ga0123356_10000124 3300010049 Bacteria 85126
112 Ga0123356_10002113 3300010049 Bacteria 21429
113 Ga0123356_10014935 3300010049 Unclassified 7450
114 Ga0466731_360324 3300042622 Bacteria 23256
115 Ga0466709_253354 3300042648 Bacteria 19722
116 AustNasuHG_c1003430 3300000089 Bacteria 5719
117 AustNasuHG_c1007562 3300000089 Bacteria 3858
118 JGI24698J34947_10014819 3300002449 Bacteria 4245
119 JGI24695J34938_10012428 3300002450 Bacteria 4511
120 JGI24695J34938_10012855 3300002450 Bacteria 4420
121 Ga0466712_094954 3300042614 Bacteria 5978
122 Ga0466712_306596 3300042614 Bacteria 2742
123 Ga0466718_126693 3300042617 Bacteria 1873
124 Ga0466726_407422 3300042619 Bacteria 3685
125 Ga0466732_212305 3300042656 Bacteria 5148
126 Ga0264413_104482 3300024493 Bacteria 4724
127 Ga0466696_018386 3300042596 Bacteria 22730
128 Ga0466696_504803 3300042596 Bacteria 23151
129 Ga0466699_378204 3300042597 Bacteria 4457
130 Ga0466716_052602 3300042605 Bacteria 5064
131 Ga0466720_041917 3300042607 Bacteria 17187
132 Ga0466722_238332 3300042609 Bacteria 2181
133 Ga0123356_10000426 3300010049 Bacteria 48138
134 Ga0466731_396239 3300042622 Bacteria 2126
135 Ga0466703_139894 3300042636 Bacteria 7763
136 Ga0466704_074771 3300042643 Bacteria 86016
137 Ga0466704_466222 3300042643 Bacteria 45364
138 Ga0466704_589010 3300042643 Bacteria 7072
139 Ga0466709_160431 3300042648 Bacteria 3198
140 AustNasuHG_c1001001 3300000089 Bacteria 10177
141 JGI24695J34938_10000731 3300002450 Bacteria 30954
142 JGI24695J34938_10004826 3300002450 Bacteria 8667
143 JGI24695J34938_10007492 3300002450 Bacteria 6382
144 Ga0466711_095440 3300042615 Bacteria 6276
145 Ga0466715_270811 3300042616 Bacteria 16378
146 Ga0466715_394356 3300042616 Bacteria 19584
147 Ga0466718_033281 3300042617 Bacteria 35431
148 Ga0466718_054025 3300042617 Bacteria 5992
149 Ga0466726_174006 3300042619 Bacteria 13818
150 Ga0466705_004176 3300042612 Bacteria 26037
151 Ga0466705_079814 3300042612 Bacteria 11344
152 Ga0466690_184614 3300042590 Unclassified 2727
153 Ga0466690_352501 3300042590 Unclassified 5668
154 Ga0466692_082619 3300042591 Bacteria 1906
155 Ga0466692_086464 3300042591 Bacteria 23953
156 Ga0466692_180850 3300042591 Bacteria 5241
157 Ga0466694_077871 3300042594 Bacteria 71235
158 Ga0466695_148876 3300042595 Bacteria 2216
159 Ga0466699_337780 3300042597 Bacteria 7977
160 Ga0466719_345398 3300042606 Bacteria 10216
161 Ga0466719_422546 3300042606 Bacteria 38458
162 Ga0466720_177676 3300042607 Bacteria 91443
163 Ga0466722_009326 3300042609 Bacteria 7148
164 Ga0123356_10000576 3300010049 Bacteria 40790
165 Ga0466704_060382 3300042643 Bacteria 33102
166 Ga0466704_090220 3300042643 Bacteria 6410
167 Ga0466708_017438 3300042652 Bacteria 2631
168 AustNasuHG_c1008190 3300000089 Bacteria 3706
169 JGI24698J34947_10013500 3300002449 Bacteria 4459
170 JGI24698J34947_10018513 3300002449 Bacteria 3761
171 JGI24702J35022_10089537 3300002462 Bacteria 1673
172 JGI24700J35501_10911089 3300002508 Bacteria 3584
173 Ga0072941_1008303 3300005201 Bacteria 14100
174 Ga0123357_10001858 3300009784 Bacteria 22927
175 Ga0466705_436006 3300042612 Bacteria 2138
176 Ga0466715_000194 3300042616 Bacteria 5288
177 Ga0466715_364165 3300042616 Bacteria 16347
178 Ga0466723_052961 3300042618 Bacteria 34600
179 Ga0466723_110384 3300042618 Bacteria 1932
180 Ga0466726_102249 3300042619 Bacteria 2593
181 Ga0466705_131848 3300042612 Bacteria 6345
182 Ga0466705_145124 3300042612 Unclassified 16840
183 Ga0160443_100063 3300012848 Bacteria 208537
184 Ga0415639_041352 3300038395 Bacteria 1783
185 Ga0466693_150660 3300042592 Bacteria 7821
186 Ga0466691_073293 3300042593 Bacteria 27182
187 Ga0466719_052414 3300042606 Bacteria 13658
188 Ga0466719_119567 3300042606 Bacteria 21802
189 Ga0466720_001519 3300042607 Unclassified 3094
190 Ga0466720_225075 3300042607 Bacteria 3386
191 Ga0466722_125896 3300042609 Bacteria 10612
192 Ga0123353_10194097 3300010167 Bacteria 3202
193 Ga0466702_434115 3300042635 Bacteria 4958
194 Ga0466703_257974 3300042636 Bacteria 4493
195 Ga0466704_053627 3300042643 Bacteria 2530
196 Ga0466704_433254 3300042643 Bacteria 10543
197 Ga0466708_452772 3300042652 Bacteria 4869
198 Ga0466727_256235 3300042655 Bacteria 2423
199 JGI24698J34947_10019510 3300002449 Unclassified 3657
200 JGI24695J34938_10000011 3300002450 Bacteria 126968
201 JGI24695J34938_10000168 3300002450 Bacteria 61343
202 JGI24695J34938_10000430 3300002450 Bacteria 40506
203 JGI24695J34938_10031169 3300002450 Bacteria 2477
204 Ga0466712_148528 3300042614 Bacteria 5793
205 Ga0466718_084956 3300042617 Bacteria 13819
206 Ga0466723_015663 3300042618 Bacteria 58778
207 Ga0466723_036632 3300042618 Bacteria 1733
208 Ga0466723_076742 3300042618 Bacteria 9218
209 Ga0466723_199441 3300042618 Bacteria 13060
210 Ga0466726_100500 3300042619 Bacteria 8675
211 Ga0466728_151120 3300042620 Bacteria 7251
212 Ga0466728_153866 3300042620 Bacteria 11970
213 Ga0466728_306601 3300042620 Bacteria 6189
214 Ga0466728_460598 3300042620 Bacteria 6412

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain 180 468 0.99
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 5 165 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03446 GO:0050661 NADP binding MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.