Protein Family IF00246
Metagenome
Isolate
184
Members
64
Samples
145
Scaffolds
435.24
Avg Length
Representative Sequence
- ID
- 3300000062|IMNBL1DRAFT_c0012804|IMNBL1DRAFT_00128043
- Length
- 424 aa
- Sequence
- MVIVMTNTIKEVLEFIDENDVKFVRLGFCDPFGTQKNISIMSDRLADAFENGISFDASSIRGFGDISKSDLLLFPDPATLTILPWRPGPGRVIRFYCDIKNPDKTPFHGDSRYLLKRIIKRCEDMGYVCKIGAECEFYLFKTDENGDPTFETLDKGGYFDIAPVDKGENIRREICLTLDEMGIKPESSRHERGPGQNEIDFVSGDALDCADNFLAFKSAVKSIAARNGLFASFLPKPILGKSGSGLHVNLSLTQNGFNIFKNSGEHSKAAESFIAGVLNRVAEMTLFLNPIPNSYERFGEDKAPKYVSWSHQNRSQLVRIPAAQGEKVRMELRSPDPTINPYIAFALIVSAGLDGIESSMQLSSPVDADLYRADKSVTDSLSALPSTLDKAIELAKNSTFVKDVVGDELFNRSIFREKYFNVM*
Sample Types
Isolate
21.2%
Metagenome
78.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
62.9%
Termitidae
25.8%
Kalotermitidae
6.5%
Passalidae
3.2%
Termopsidae
1.6%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 4 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 5 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 6 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 7 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 8 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 9 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 10 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 11 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 12 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 13 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 14 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 21 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 22 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 23 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 24 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 25 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 29 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 30 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 41 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 42 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 46 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 47 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 52 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 53 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 54 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 55 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 59 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 60 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 61 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 62 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 63 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 64 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_070888 | 3300042614 | Bacteria | 8953 |
| 2 | Ga0466712_106495 | 3300042614 | Bacteria | 6276 |
| 3 | Ga0466712_300092 | 3300042614 | Bacteria | 27661 |
| 4 | Ga0466718_099723 | 3300042617 | Bacteria | 3033 |
| 5 | Ga0466720_044774 | 3300042607 | Bacteria | 3543 |
| 6 | Ga0264413_131002 | 3300024493 | Bacteria | 2600 |
| 7 | Ga0466693_324905 | 3300042592 | Bacteria | 11159 |
| 8 | Ga0466699_062387 | 3300042597 | Unclassified | 3933 |
| 9 | Ga0466699_183939 | 3300042597 | Bacteria | 4710 |
| 10 | Ga0466699_322346 | 3300042597 | Bacteria | 2038 |
| 11 | Ga0466699_377273 | 3300042597 | Bacteria | 6704 |
| 12 | AustNasuHG_c1008857 | 3300000089 | Bacteria | 3557 |
| 13 | JGI24698J34947_10001674 | 3300002449 | Bacteria | 11831 |
| 14 | JGI24698J34947_10035637 | 3300002449 | Unclassified | 2596 |
| 15 | JGI24695J34938_10000124 | 3300002450 | Bacteria | 68793 |
| 16 | JGI24695J34938_10034943 | 3300002450 | Bacteria | 2302 |
| 17 | Ga0072941_1009739 | 3300005201 | Bacteria | 6697 |
| 18 | Ga0072941_1013714 | 3300005201 | Bacteria | 10945 |
| 19 | Ga0466712_036942 | 3300042614 | Bacteria | 13216 |
| 20 | Ga0466712_054915 | 3300042614 | Bacteria | 81067 |
| 21 | Ga0466712_087859 | 3300042614 | Bacteria | 3412 |
| 22 | Ga0466718_011452 | 3300042617 | Bacteria | 22863 |
| 23 | Ga0466718_014968 | 3300042617 | Bacteria | 3593 |
| 24 | Ga0123353_10007950 | 3300010167 | Unclassified | 14419 |
| 25 | Ga0123353_10329777 | 3300010167 | Bacteria | 2311 |
| 26 | Ga0466693_139838 | 3300042592 | Bacteria | 2223 |
| 27 | Ga0466699_400721 | 3300042597 | Bacteria | 1856 |
| 28 | Ga0466702_062256 | 3300042635 | Bacteria | 47552 |
| 29 | Ga0466704_376347 | 3300042643 | Bacteria | 2976 |
| 30 | Ga0466725_312176 | 3300042654 | Bacteria | 2548 |
| 31 | JGI24698J34947_10001380 | 3300002449 | Unclassified | 12773 |
| 32 | JGI24698J34947_10010901 | 3300002449 | Bacteria | 4987 |
| 33 | JGI24698J34947_10045745 | 3300002449 | Unclassified | 2231 |
| 34 | JGI24695J34938_10000178 | 3300002450 | Bacteria | 59181 |
| 35 | JGI24695J34938_10008898 | 3300002450 | Bacteria | 5667 |
| 36 | JGI24695J34938_10013216 | 3300002450 | Bacteria | 4343 |
| 37 | JGI24695J34938_10039857 | 3300002450 | Bacteria | 2119 |
| 38 | Ga0072941_1174203 | 3300005201 | Bacteria | 4562 |
| 39 | Ga0466712_025797 | 3300042614 | Bacteria | 10187 |
| 40 | Ga0466718_016781 | 3300042617 | Bacteria | 2253 |
| 41 | Ga0466726_147397 | 3300042619 | Bacteria | 25207 |
| 42 | Ga0466698_456030 | 3300042610 | Bacteria | 6658 |
| 43 | Ga0466699_209614 | 3300042597 | Bacteria | 2098 |
| 44 | JGI24695J34938_10002612 | 3300002450 | Bacteria | 13549 |
| 45 | JGI24695J34938_10005698 | 3300002450 | Bacteria | 7689 |
| 46 | Ga0072941_1023139 | 3300005201 | Bacteria | 44385 |
| 47 | Ga0072941_1063915 | 3300005201 | Bacteria | 7644 |
| 48 | Ga0466712_106537 | 3300042614 | Bacteria | 1736 |
| 49 | Ga0466712_164294 | 3300042614 | Bacteria | 13645 |
| 50 | Ga0466712_237938 | 3300042614 | Bacteria | 2967 |
| 51 | Ga0466712_307228 | 3300042614 | Bacteria | 9186 |
| 52 | Ga0466723_140378 | 3300042618 | Bacteria | 11971 |
| 53 | Ga0466720_175778 | 3300042607 | Bacteria | 11373 |
| 54 | Ga0466698_267205 | 3300042610 | Bacteria | 4126 |
| 55 | Ga0466699_061863 | 3300042597 | Bacteria | 4078 |
| 56 | Ga0466699_110647 | 3300042597 | Bacteria | 8204 |
| 57 | Ga0466699_151062 | 3300042597 | Bacteria | 24951 |
| 58 | Ga0466699_218045 | 3300042597 | Bacteria | 3638 |
| 59 | Ga0466730_026282 | 3300042625 | Bacteria | 7380 |
| 60 | 2227480180 | 2225789004 | Bacteria | 81364 |
| 61 | JGI24698J34947_10004350 | 3300002449 | Bacteria | 7710 |
| 62 | JGI24698J34947_10004808 | 3300002449 | Bacteria | 7386 |
| 63 | JGI24698J34947_10021944 | 3300002449 | Bacteria | 3428 |
| 64 | JGI24695J34938_10000486 | 3300002450 | Bacteria | 38538 |
| 65 | JGI24695J34938_10003293 | 3300002450 | Bacteria | 11384 |
| 66 | JGI24695J34938_10050940 | 3300002450 | Bacteria | 1814 |
| 67 | Ga0072940_1000304 | 3300005200 | Bacteria | 17618 |
| 68 | Ga0072941_1039423 | 3300005201 | Bacteria | 6469 |
| 69 | Ga0466705_531718 | 3300042612 | Bacteria | 12937 |
| 70 | Ga0466712_021182 | 3300042614 | Bacteria | 18924 |
| 71 | Ga0466712_114117 | 3300042614 | Bacteria | 6714 |
| 72 | Ga0466726_262759 | 3300042619 | Bacteria | 2856 |
| 73 | Ga0123353_10088483 | 3300010167 | Bacteria | 4987 |
| 74 | Ga0264413_107893 | 3300024493 | Bacteria | 20055 |
| 75 | Ga0264413_112704 | 3300024493 | Bacteria | 11398 |
| 76 | Ga0415639_204585 | 3300038395 | Bacteria | 3599 |
| 77 | Ga0466691_123834 | 3300042593 | Bacteria | 7409 |
| 78 | Ga0466699_003639 | 3300042597 | Bacteria | 6449 |
| 79 | Ga0466699_064287 | 3300042597 | Bacteria | 9252 |
| 80 | Ga0466699_087433 | 3300042597 | Bacteria | 2316 |
| 81 | Ga0466699_441266 | 3300042597 | Bacteria | 28353 |
| 82 | Ga0466702_063273 | 3300042635 | Bacteria | 11189 |
| 83 | IMNBL1DRAFT_c0012804 | 3300000062 | Bacteria | 3810 |
| 84 | JGI24698J34947_10003097 | 3300002449 | Bacteria | 9009 |
| 85 | JGI24698J34947_10003566 | 3300002449 | Bacteria | 8450 |
| 86 | JGI24695J34938_10000034 | 3300002450 | Bacteria | 102252 |
| 87 | Ga0072941_1024445 | 3300005201 | Bacteria | 10667 |
| 88 | Ga0466712_062962 | 3300042614 | Bacteria | 14517 |
| 89 | Ga0466712_166194 | 3300042614 | Bacteria | 8685 |
| 90 | Ga0466718_111287 | 3300042617 | Unclassified | 3707 |
| 91 | Ga0123353_10066744 | 3300010167 | Bacteria | 5776 |
| 92 | Ga0123353_10129843 | 3300010167 | Bacteria | 4045 |
| 93 | Ga0466698_170798 | 3300042610 | Bacteria | 3591 |
| 94 | Ga0415639_178804 | 3300038395 | Bacteria | 1968 |
| 95 | Ga0466693_269113 | 3300042592 | Bacteria | 1933 |
| 96 | Ga0466699_068049 | 3300042597 | Bacteria | 2193 |
| 97 | Ga0466699_282773 | 3300042597 | Bacteria | 3907 |
| 98 | Ga0466699_320466 | 3300042597 | Bacteria | 5329 |
| 99 | Ga0466704_240234 | 3300042643 | Bacteria | 65177 |
| 100 | IMNBL1DRAFT_c0000032 | 3300000062 | Bacteria | 125696 |
| 101 | JGI24698J34947_10009024 | 3300002449 | Bacteria | 5470 |
| 102 | JGI24698J34947_10023742 | 3300002449 | Unclassified | 3279 |
| 103 | JGI24695J34938_10000172 | 3300002450 | Bacteria | 60289 |
| 104 | Ga0072941_1000814 | 3300005201 | Bacteria | 23587 |
| 105 | Ga0466712_034270 | 3300042614 | Unclassified | 2233 |
| 106 | Ga0466712_037892 | 3300042614 | Bacteria | 6381 |
| 107 | Ga0466712_160427 | 3300042614 | Bacteria | 2340 |
| 108 | Ga0466718_144755 | 3300042617 | Bacteria | 4126 |
| 109 | Ga0264413_102249 | 3300024493 | Bacteria | 30809 |
| 110 | Ga0466693_409460 | 3300042592 | Bacteria | 15146 |
| 111 | Ga0466699_102972 | 3300042597 | Bacteria | 6510 |
| 112 | Ga0466699_309643 | 3300042597 | Bacteria | 10189 |
| 113 | Ga0466699_356521 | 3300042597 | Bacteria | 4359 |
| 114 | Ga0466699_381649 | 3300042597 | Bacteria | 11631 |
| 115 | Ga0466699_396900 | 3300042597 | Bacteria | 2776 |
| 116 | Ga0466699_415041 | 3300042597 | Bacteria | 3638 |
| 117 | Ga0466702_000318 | 3300042635 | Bacteria | 11365 |
| 118 | Ga0466725_173280 | 3300042654 | Bacteria | 4521 |
| 119 | IMNBL1DRAFT_c0003766 | 3300000062 | Unclassified | 9489 |
| 120 | JGI24698J34947_10000009 | 3300002449 | Bacteria | 50359 |
| 121 | JGI24698J34947_10032191 | 3300002449 | Bacteria | 2754 |
| 122 | JGI24698J34947_10060369 | 3300002449 | Unclassified | 1871 |
| 123 | JGI24695J34938_10000258 | 3300002450 | Bacteria | 51430 |
| 124 | JGI24695J34938_10004025 | 3300002450 | Bacteria | 9875 |
| 125 | JGI24695J34938_10007252 | 3300002450 | Bacteria | 6530 |
| 126 | JGI24695J34938_10007314 | 3300002450 | Bacteria | 6492 |
| 127 | JGI24695J34938_10029432 | 3300002450 | Unclassified | 2570 |
| 128 | JGI24702J35022_10003665 | 3300002462 | Bacteria | 9243 |
| 129 | Ga0466712_239189 | 3300042614 | Bacteria | 7037 |
| 130 | Ga0466718_115456 | 3300042617 | Bacteria | 12484 |
| 131 | Ga0415639_001871 | 3300038395 | Bacteria | 12926 |
| 132 | Ga0415639_050696 | 3300038395 | Bacteria | 3968 |
| 133 | Ga0466702_163945 | 3300042635 | Bacteria | 4966 |
| 134 | IMNBL1DRAFT_c0002438 | 3300000062 | Bacteria | 12945 |
| 135 | AustNasuHG_c1001183 | 3300000089 | Bacteria | 9378 |
| 136 | JGI24698J34947_10000863 | 3300002449 | Bacteria | 15282 |
| 137 | JGI24698J34947_10008013 | 3300002449 | Bacteria | 5799 |
| 138 | JGI24698J34947_10014603 | 3300002449 | Bacteria | 4278 |
| 139 | JGI24698J34947_10037787 | 3300002449 | Bacteria | 2506 |
| 140 | JGI24695J34938_10002292 | 3300002450 | Bacteria | 14765 |
| 141 | JGI24695J34938_10003368 | 3300002450 | Bacteria | 11241 |
| 142 | JGI24695J34938_10003464 | 3300002450 | Bacteria | 11008 |
| 143 | JGI24695J34938_10008790 | 3300002450 | Bacteria | 5721 |
| 144 | Ga0072941_1018149 | 3300005201 | Bacteria | 8007 |
| 145 | Ga0072941_1040323 | 3300005201 | Bacteria | 6819 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.