Protein Family IF00246

Metagenome Isolate
184 Members
64 Samples
145 Scaffolds
435.24 Avg Length

🧬 Representative Sequence

ID
3300000062|IMNBL1DRAFT_c0012804|IMNBL1DRAFT_00128043
Length
424 aa
Sequence
MVIVMTNTIKEVLEFIDENDVKFVRLGFCDPFGTQKNISIMSDRLADAFENGISFDASSIRGFGDISKSDLLLFPDPATLTILPWRPGPGRVIRFYCDIKNPDKTPFHGDSRYLLKRIIKRCEDMGYVCKIGAECEFYLFKTDENGDPTFETLDKGGYFDIAPVDKGENIRREICLTLDEMGIKPESSRHERGPGQNEIDFVSGDALDCADNFLAFKSAVKSIAARNGLFASFLPKPILGKSGSGLHVNLSLTQNGFNIFKNSGEHSKAAESFIAGVLNRVAEMTLFLNPIPNSYERFGEDKAPKYVSWSHQNRSQLVRIPAAQGEKVRMELRSPDPTINPYIAFALIVSAGLDGIESSMQLSSPVDADLYRADKSVTDSLSALPSTLDKAIELAKNSTFVKDVVGDELFNRSIFREKYFNVM*

πŸ“Š Sample Types

Isolate 21.2%
Metagenome 78.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 62.9%
Termitidae 25.8%
Kalotermitidae 6.5%
Passalidae 3.2%
Termopsidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
4 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
5 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
6 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
7 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
8 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
9 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
10 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
11 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
12 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
13 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
14 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
21 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
22 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
23 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
24 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
25 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
29 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
30 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
31 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
41 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
42 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
43 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
46 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
47 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
52 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
53 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
54 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
55 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
59 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
60 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
61 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
62 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
63 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
64 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_070888 3300042614 Bacteria 8953
2 Ga0466712_106495 3300042614 Bacteria 6276
3 Ga0466712_300092 3300042614 Bacteria 27661
4 Ga0466718_099723 3300042617 Bacteria 3033
5 Ga0466720_044774 3300042607 Bacteria 3543
6 Ga0264413_131002 3300024493 Bacteria 2600
7 Ga0466693_324905 3300042592 Bacteria 11159
8 Ga0466699_062387 3300042597 Unclassified 3933
9 Ga0466699_183939 3300042597 Bacteria 4710
10 Ga0466699_322346 3300042597 Bacteria 2038
11 Ga0466699_377273 3300042597 Bacteria 6704
12 AustNasuHG_c1008857 3300000089 Bacteria 3557
13 JGI24698J34947_10001674 3300002449 Bacteria 11831
14 JGI24698J34947_10035637 3300002449 Unclassified 2596
15 JGI24695J34938_10000124 3300002450 Bacteria 68793
16 JGI24695J34938_10034943 3300002450 Bacteria 2302
17 Ga0072941_1009739 3300005201 Bacteria 6697
18 Ga0072941_1013714 3300005201 Bacteria 10945
19 Ga0466712_036942 3300042614 Bacteria 13216
20 Ga0466712_054915 3300042614 Bacteria 81067
21 Ga0466712_087859 3300042614 Bacteria 3412
22 Ga0466718_011452 3300042617 Bacteria 22863
23 Ga0466718_014968 3300042617 Bacteria 3593
24 Ga0123353_10007950 3300010167 Unclassified 14419
25 Ga0123353_10329777 3300010167 Bacteria 2311
26 Ga0466693_139838 3300042592 Bacteria 2223
27 Ga0466699_400721 3300042597 Bacteria 1856
28 Ga0466702_062256 3300042635 Bacteria 47552
29 Ga0466704_376347 3300042643 Bacteria 2976
30 Ga0466725_312176 3300042654 Bacteria 2548
31 JGI24698J34947_10001380 3300002449 Unclassified 12773
32 JGI24698J34947_10010901 3300002449 Bacteria 4987
33 JGI24698J34947_10045745 3300002449 Unclassified 2231
34 JGI24695J34938_10000178 3300002450 Bacteria 59181
35 JGI24695J34938_10008898 3300002450 Bacteria 5667
36 JGI24695J34938_10013216 3300002450 Bacteria 4343
37 JGI24695J34938_10039857 3300002450 Bacteria 2119
38 Ga0072941_1174203 3300005201 Bacteria 4562
39 Ga0466712_025797 3300042614 Bacteria 10187
40 Ga0466718_016781 3300042617 Bacteria 2253
41 Ga0466726_147397 3300042619 Bacteria 25207
42 Ga0466698_456030 3300042610 Bacteria 6658
43 Ga0466699_209614 3300042597 Bacteria 2098
44 JGI24695J34938_10002612 3300002450 Bacteria 13549
45 JGI24695J34938_10005698 3300002450 Bacteria 7689
46 Ga0072941_1023139 3300005201 Bacteria 44385
47 Ga0072941_1063915 3300005201 Bacteria 7644
48 Ga0466712_106537 3300042614 Bacteria 1736
49 Ga0466712_164294 3300042614 Bacteria 13645
50 Ga0466712_237938 3300042614 Bacteria 2967
51 Ga0466712_307228 3300042614 Bacteria 9186
52 Ga0466723_140378 3300042618 Bacteria 11971
53 Ga0466720_175778 3300042607 Bacteria 11373
54 Ga0466698_267205 3300042610 Bacteria 4126
55 Ga0466699_061863 3300042597 Bacteria 4078
56 Ga0466699_110647 3300042597 Bacteria 8204
57 Ga0466699_151062 3300042597 Bacteria 24951
58 Ga0466699_218045 3300042597 Bacteria 3638
59 Ga0466730_026282 3300042625 Bacteria 7380
60 2227480180 2225789004 Bacteria 81364
61 JGI24698J34947_10004350 3300002449 Bacteria 7710
62 JGI24698J34947_10004808 3300002449 Bacteria 7386
63 JGI24698J34947_10021944 3300002449 Bacteria 3428
64 JGI24695J34938_10000486 3300002450 Bacteria 38538
65 JGI24695J34938_10003293 3300002450 Bacteria 11384
66 JGI24695J34938_10050940 3300002450 Bacteria 1814
67 Ga0072940_1000304 3300005200 Bacteria 17618
68 Ga0072941_1039423 3300005201 Bacteria 6469
69 Ga0466705_531718 3300042612 Bacteria 12937
70 Ga0466712_021182 3300042614 Bacteria 18924
71 Ga0466712_114117 3300042614 Bacteria 6714
72 Ga0466726_262759 3300042619 Bacteria 2856
73 Ga0123353_10088483 3300010167 Bacteria 4987
74 Ga0264413_107893 3300024493 Bacteria 20055
75 Ga0264413_112704 3300024493 Bacteria 11398
76 Ga0415639_204585 3300038395 Bacteria 3599
77 Ga0466691_123834 3300042593 Bacteria 7409
78 Ga0466699_003639 3300042597 Bacteria 6449
79 Ga0466699_064287 3300042597 Bacteria 9252
80 Ga0466699_087433 3300042597 Bacteria 2316
81 Ga0466699_441266 3300042597 Bacteria 28353
82 Ga0466702_063273 3300042635 Bacteria 11189
83 IMNBL1DRAFT_c0012804 3300000062 Bacteria 3810
84 JGI24698J34947_10003097 3300002449 Bacteria 9009
85 JGI24698J34947_10003566 3300002449 Bacteria 8450
86 JGI24695J34938_10000034 3300002450 Bacteria 102252
87 Ga0072941_1024445 3300005201 Bacteria 10667
88 Ga0466712_062962 3300042614 Bacteria 14517
89 Ga0466712_166194 3300042614 Bacteria 8685
90 Ga0466718_111287 3300042617 Unclassified 3707
91 Ga0123353_10066744 3300010167 Bacteria 5776
92 Ga0123353_10129843 3300010167 Bacteria 4045
93 Ga0466698_170798 3300042610 Bacteria 3591
94 Ga0415639_178804 3300038395 Bacteria 1968
95 Ga0466693_269113 3300042592 Bacteria 1933
96 Ga0466699_068049 3300042597 Bacteria 2193
97 Ga0466699_282773 3300042597 Bacteria 3907
98 Ga0466699_320466 3300042597 Bacteria 5329
99 Ga0466704_240234 3300042643 Bacteria 65177
100 IMNBL1DRAFT_c0000032 3300000062 Bacteria 125696
101 JGI24698J34947_10009024 3300002449 Bacteria 5470
102 JGI24698J34947_10023742 3300002449 Unclassified 3279
103 JGI24695J34938_10000172 3300002450 Bacteria 60289
104 Ga0072941_1000814 3300005201 Bacteria 23587
105 Ga0466712_034270 3300042614 Unclassified 2233
106 Ga0466712_037892 3300042614 Bacteria 6381
107 Ga0466712_160427 3300042614 Bacteria 2340
108 Ga0466718_144755 3300042617 Bacteria 4126
109 Ga0264413_102249 3300024493 Bacteria 30809
110 Ga0466693_409460 3300042592 Bacteria 15146
111 Ga0466699_102972 3300042597 Bacteria 6510
112 Ga0466699_309643 3300042597 Bacteria 10189
113 Ga0466699_356521 3300042597 Bacteria 4359
114 Ga0466699_381649 3300042597 Bacteria 11631
115 Ga0466699_396900 3300042597 Bacteria 2776
116 Ga0466699_415041 3300042597 Bacteria 3638
117 Ga0466702_000318 3300042635 Bacteria 11365
118 Ga0466725_173280 3300042654 Bacteria 4521
119 IMNBL1DRAFT_c0003766 3300000062 Unclassified 9489
120 JGI24698J34947_10000009 3300002449 Bacteria 50359
121 JGI24698J34947_10032191 3300002449 Bacteria 2754
122 JGI24698J34947_10060369 3300002449 Unclassified 1871
123 JGI24695J34938_10000258 3300002450 Bacteria 51430
124 JGI24695J34938_10004025 3300002450 Bacteria 9875
125 JGI24695J34938_10007252 3300002450 Bacteria 6530
126 JGI24695J34938_10007314 3300002450 Bacteria 6492
127 JGI24695J34938_10029432 3300002450 Unclassified 2570
128 JGI24702J35022_10003665 3300002462 Bacteria 9243
129 Ga0466712_239189 3300042614 Bacteria 7037
130 Ga0466718_115456 3300042617 Bacteria 12484
131 Ga0415639_001871 3300038395 Bacteria 12926
132 Ga0415639_050696 3300038395 Bacteria 3968
133 Ga0466702_163945 3300042635 Bacteria 4966
134 IMNBL1DRAFT_c0002438 3300000062 Bacteria 12945
135 AustNasuHG_c1001183 3300000089 Bacteria 9378
136 JGI24698J34947_10000863 3300002449 Bacteria 15282
137 JGI24698J34947_10008013 3300002449 Bacteria 5799
138 JGI24698J34947_10014603 3300002449 Bacteria 4278
139 JGI24698J34947_10037787 3300002449 Bacteria 2506
140 JGI24695J34938_10002292 3300002450 Bacteria 14765
141 JGI24695J34938_10003368 3300002450 Bacteria 11241
142 JGI24695J34938_10003464 3300002450 Bacteria 11008
143 JGI24695J34938_10008790 3300002450 Bacteria 5721
144 Ga0072941_1018149 3300005201 Bacteria 8007
145 Ga0072941_1040323 3300005201 Bacteria 6819

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 20 102 0.98
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 109 411 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.