Protein Family IF00002
Metagenome
Metatranscriptome
Isolate
134
Members
43
Samples
129
Scaffolds
236.58
Avg Length
Representative Sequence
- ID
- 2030936001|Nasutiter_Contig18609|Nasutiterm_2196770
- Length
- 268 aa
- Sequence
- MKVMEKEGMVVNWSDILFNSPHAERYRKTNWRIMFMHNTENLSNYYDLLGVNRESSSSQIKKAFREKAKQLHPDIAGSDQSEAMRKLISAYEILSNPERRYEYDRAYSRFVKKAGFNYRTWLNEQDDPESQAKLVFFELLHLQEEQAIAVWRKNGGLDFLLNKYLDKEDWMDCQYILAEELDKRGFTYEAFRLSAAVLAEERRRPYFKIFTAEIEKFIKSIVRQKLKHQVDKETWIDCMETMVSLGFSARDEKRYMRYMADTLEKLRA
Sample Types
Isolate
3.7%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.2%
Kalotermitidae
29.3%
Unclassified
12.2%
Rhinotermitidae
4.9%
Termopsidae
2.4%
Taxonomy
Archaea
1
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 36 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466716_004127 | 3300042605 | Bacteria | 19130 |
| 2 | Ga0466720_067539 | 3300042607 | Bacteria | 32042 |
| 3 | Ga0466722_140791 | 3300042609 | Bacteria | 30365 |
| 4 | Ga0255786_1000339 | 3300022815 | Bacteria | 2647 |
| 5 | Ga0264413_128808 | 3300024493 | Bacteria | 1926 |
| 6 | Ga0415639_160200 | 3300038395 | Bacteria | 2266 |
| 7 | Ga0466694_061918 | 3300042594 | Bacteria | 2938 |
| 8 | Ga0466694_064514 | 3300042594 | Bacteria | 49364 |
| 9 | Ga0123356_10019089 | 3300010049 | Bacteria | 6502 |
| 10 | JGI24698J34947_10016628 | 3300002449 | Bacteria | 3991 |
| 11 | Ga0072941_1001733 | 3300005201 | Bacteria | 27546 |
| 12 | Ga0072941_1029428 | 3300005201 | Bacteria | 1535 |
| 13 | Ga0072941_1078560 | 3300005201 | Bacteria | 3271 |
| 14 | Ga0072941_1128740 | 3300005201 | Bacteria | 3079 |
| 15 | Ga0466712_066859 | 3300042614 | Bacteria | 17566 |
| 16 | Ga0466712_096882 | 3300042614 | Bacteria | 42313 |
| 17 | Ga0466712_321604 | 3300042614 | Bacteria | 1423 |
| 18 | Ga0466723_069830 | 3300042618 | Bacteria | 59394 |
| 19 | Ga0466731_122857 | 3300042622 | Bacteria | 1844 |
| 20 | Ga0466702_013549 | 3300042635 | Bacteria | 1808 |
| 21 | Ga0466704_133824 | 3300042643 | Bacteria | 15469 |
| 22 | Ga0466720_040398 | 3300042607 | Bacteria | 4140 |
| 23 | Ga0466721_282865 | 3300042608 | Bacteria | 3385 |
| 24 | Ga0466732_149862 | 3300042656 | Bacteria | 25512 |
| 25 | Ga0466699_078894 | 3300042597 | Bacteria | 2536 |
| 26 | Ga0123356_10001171 | 3300010049 | Bacteria | 29024 |
| 27 | Nasutiter_Contig18609 | 2030936001 | Bacteria | 2094 |
| 28 | JGI24698J34947_10001809 | 3300002449 | Bacteria | 11411 |
| 29 | JGI24698J34947_10002702 | 3300002449 | Bacteria | 9575 |
| 30 | JGI24695J34938_10000034 | 3300002450 | Bacteria | 102252 |
| 31 | JGI24695J34938_10000090 | 3300002450 | Bacteria | 79670 |
| 32 | Ga0072941_1187355 | 3300005201 | Bacteria | 2031 |
| 33 | Ga0466705_481415 | 3300042612 | Bacteria | 10350 |
| 34 | Ga0466718_006492 | 3300042617 | Bacteria | 5152 |
| 35 | Ga0466702_096891 | 3300042635 | Bacteria | 5454 |
| 36 | Ga0415639_034740 | 3300038395 | Bacteria | 2879 |
| 37 | Ga0466694_010922 | 3300042594 | Bacteria | 2935 |
| 38 | Ga0466694_085676 | 3300042594 | Bacteria | 6201 |
| 39 | Ga0123356_10677138 | 3300010049 | Bacteria | 1200 |
| 40 | JGI24698J34947_10002785 | 3300002449 | Bacteria | 9467 |
| 41 | JGI24698J34947_10007900 | 3300002449 | Bacteria | 5844 |
| 42 | JGI24698J34947_10007941 | 3300002449 | Bacteria | 5827 |
| 43 | JGI24698J34947_10024116 | 3300002449 | Bacteria | 3250 |
| 44 | JGI24698J34947_10060740 | 3300002449 | Bacteria | 1863 |
| 45 | Ga0466712_003932 | 3300042614 | Bacteria | 1716 |
| 46 | Ga0466712_043689 | 3300042614 | Bacteria | 6200 |
| 47 | Ga0466712_313417 | 3300042614 | Bacteria | 20202 |
| 48 | Ga0466718_000437 | 3300042617 | Bacteria | 6193 |
| 49 | Ga0466718_014084 | 3300042617 | Bacteria | 9337 |
| 50 | Ga0466718_098402 | 3300042617 | Bacteria | 5328 |
| 51 | Ga0466723_287515 | 3300042618 | Bacteria | 14214 |
| 52 | Ga0466735_053746 | 3300042624 | Bacteria | 2906 |
| 53 | Ga0466702_262024 | 3300042635 | Bacteria | 19372 |
| 54 | Ga0466722_188440 | 3300042609 | Bacteria | 3796 |
| 55 | Ga0466698_011176 | 3300042610 | Bacteria | 17753 |
| 56 | Ga0264413_100206 | 3300024493 | Bacteria | 2253 |
| 57 | Ga0264413_106415 | 3300024493 | Bacteria | 1313 |
| 58 | Ga0264413_107168 | 3300024493 | Bacteria | 47740 |
| 59 | Ga0264413_116627 | 3300024493 | Archaea | 4585 |
| 60 | Ga0466690_002751 | 3300042590 | Bacteria | 16420 |
| 61 | Ga0466692_106643 | 3300042591 | Bacteria | 23149 |
| 62 | Ga0466699_027011 | 3300042597 | Bacteria | 4620 |
| 63 | Ga0466699_165217 | 3300042597 | Bacteria | 13505 |
| 64 | Ga0123357_10125138 | 3300009784 | Bacteria | 3223 |
| 65 | Ga0123356_10004765 | 3300010049 | Bacteria | 13956 |
| 66 | AustNasuHG_c1000005 | 3300000089 | Bacteria | 56942 |
| 67 | AustNasuHG_c1031215 | 3300000089 | Bacteria | 1511 |
| 68 | JGI24698J34947_10001592 | 3300002449 | Bacteria | 12046 |
| 69 | JGI24698J34947_10020479 | 3300002449 | Bacteria | 3561 |
| 70 | JGI24698J34947_10051179 | 3300002449 | Bacteria | 2079 |
| 71 | Ga0466718_139511 | 3300042617 | Bacteria | 3770 |
| 72 | Ga0466702_356971 | 3300042635 | Bacteria | 1796 |
| 73 | Ga0466708_436074 | 3300042652 | Bacteria | 8064 |
| 74 | Ga0466694_011295 | 3300042594 | Bacteria | 21289 |
| 75 | Ga0466694_092760 | 3300042594 | Bacteria | 30658 |
| 76 | Ga0072941_1008564 | 3300005201 | Bacteria | 7816 |
| 77 | Ga0072941_1019152 | 3300005201 | Unclassified | 3777 |
| 78 | Ga0072941_1083459 | 3300005201 | Bacteria | 5085 |
| 79 | Ga0466718_094669 | 3300042617 | Bacteria | 12438 |
| 80 | Ga0466718_096890 | 3300042617 | Bacteria | 1317 |
| 81 | Ga0466735_204380 | 3300042624 | Bacteria | 2684 |
| 82 | Ga0466716_119424 | 3300042605 | Bacteria | 30510 |
| 83 | Ga0466719_145174 | 3300042606 | Bacteria | 49253 |
| 84 | Ga0415639_072113 | 3300038395 | Bacteria | 986 |
| 85 | Ga0466692_162226 | 3300042591 | Bacteria | 5497 |
| 86 | Ga0466691_014585 | 3300042593 | Bacteria | 20179 |
| 87 | Ga0466694_271285 | 3300042594 | Bacteria | 1385 |
| 88 | Ga0466699_011117 | 3300042597 | Bacteria | 1817 |
| 89 | JGI24698J34947_10001843 | 3300002449 | Bacteria | 11307 |
| 90 | JGI24698J34947_10011588 | 3300002449 | Bacteria | 4841 |
| 91 | JGI24698J34947_10084773 | 3300002449 | Unclassified | 1474 |
| 92 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 93 | JGI24695J34938_10039897 | 3300002450 | Bacteria | 2117 |
| 94 | Ga0072941_1004258 | 3300005201 | Bacteria | 9122 |
| 95 | Ga0072941_1108211 | 3300005201 | Bacteria | 1999 |
| 96 | Ga0466712_028735 | 3300042614 | Bacteria | 38990 |
| 97 | Ga0466712_035454 | 3300042614 | Bacteria | 21926 |
| 98 | Ga0466718_010881 | 3300042617 | Bacteria | 2290 |
| 99 | Ga0264413_102311 | 3300024493 | Bacteria | 23114 |
| 100 | Ga0466701_011177 | 3300042598 | Bacteria | 1035 |
| 101 | Ga0123354_10378206 | 3300010882 | Unclassified | 1226 |
| 102 | JGI24698J34947_10110380 | 3300002449 | Bacteria | 1216 |
| 103 | JGI24695J34938_10006897 | 3300002450 | Bacteria | 6743 |
| 104 | Ga0072941_1259230 | 3300005201 | Bacteria | 2380 |
| 105 | Ga0466712_039240 | 3300042614 | Bacteria | 23177 |
| 106 | Ga0466711_310728 | 3300042615 | Bacteria | 12530 |
| 107 | Ga0466718_046216 | 3300042617 | Bacteria | 3669 |
| 108 | Ga0466718_083414 | 3300042617 | Bacteria | 1575 |
| 109 | Ga0466718_152670 | 3300042617 | Bacteria | 7225 |
| 110 | Ga0466728_103464 | 3300042620 | Bacteria | 27893 |
| 111 | Ga0466731_229103 | 3300042622 | Bacteria | 2459 |
| 112 | Ga0466702_349925 | 3300042635 | Bacteria | 1684 |
| 113 | Ga0466700_009779 | 3300042600 | Bacteria | 2411 |
| 114 | Ga0466720_044223 | 3300042607 | Bacteria | 4336 |
| 115 | Ga0466720_045337 | 3300042607 | Bacteria | 10655 |
| 116 | Ga0466732_402929 | 3300042656 | Bacteria | 3380 |
| 117 | Ga0466699_420355 | 3300042597 | Bacteria | 7481 |
| 118 | Ga0123356_10064051 | 3300010049 | Bacteria | 3436 |
| 119 | JGI24698J34947_10000264 | 3300002449 | Bacteria | 22404 |
| 120 | JGI24698J34947_10020922 | 3300002449 | Bacteria | 3522 |
| 121 | JGI24698J34947_10055318 | 3300002449 | Bacteria | 1977 |
| 122 | JGI24698J34947_10075599 | 3300002449 | Bacteria | 1601 |
| 123 | Ga0072941_1006115 | 3300005201 | Bacteria | 5434 |
| 124 | Ga0466712_026582 | 3300042614 | Bacteria | 12812 |
| 125 | Ga0466712_127955 | 3300042614 | Bacteria | 54818 |
| 126 | Ga0466712_152932 | 3300042614 | Bacteria | 25376 |
| 127 | Ga0466712_269723 | 3300042614 | Bacteria | 3433 |
| 128 | Ga0466703_315219 | 3300042636 | Bacteria | 14962 |
| 129 | Ga0466709_104493 | 3300042648 | Bacteria | 13448 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00226 | DnaJ | DnaJ domain | 44 | 104 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.