x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300028244
3300028244: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_D
Overview
Basic Information
IMG/M Taxon OID 3300028244 Open in IMG/M GOLD Reference Gs0133410 | Gp0290884 | Ga0247714 Sample Name Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_D Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 24156293 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States Type Environmental Taxonomy Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States
Alternative Ecosystem Assignments
Environment Ontology (ENVO) terrestrial biome → hill → soil Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
Location Information
Location USA: Arizona Coordinates Lat. (o ) 32.5789 Long. (o ) -110.8512 Alt. (m) N/A Depth (m) 0 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F030521 Metagenome 185 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0247714_104309 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria 666 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0247714_104309 Ga0247714_1043093 F030521 VVAMTLFHTHEAAAAAMGAGAHALVGKESFVPGLAQALAALFPA
