NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028244

3300028244: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_D



Overview

Basic Information
IMG/M Taxon OID3300028244 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133410 | Gp0290884 | Ga0247714
Sample NameSoil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size24156293
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomehillsoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Arizona
CoordinatesLat. (o)32.5789Long. (o)-110.8512Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030521Metagenome185Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247714_104309All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria666Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247714_104309Ga0247714_1043093F030521VVAMTLFHTHEAAAAAMGAGAHALVGKESFVPGLAQALAALFPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.