NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026698

3300026698: Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN411 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026698 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053063 | Gp0054414 | Ga0208843
Sample NameForest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN411 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13461771
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → land → fertilized soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWillamette National Forest, Oregon, USA
CoordinatesLat. (o)44.20517707Long. (o)-122.1284473Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003101Metagenome / Metatranscriptome507Y
F003395Metagenome / Metatranscriptome489Y
F041900Metagenome / Metatranscriptome159Y
F055029Metagenome / Metatranscriptome139Y
F081678Metagenome / Metatranscriptome114Y
F084660Metagenome / Metatranscriptome112N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208843_100336Not Available756Open in IMG/M
Ga0208843_100457All Organisms → cellular organisms → Bacteria688Open in IMG/M
Ga0208843_100618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae631Open in IMG/M
Ga0208843_100758Not Available590Open in IMG/M
Ga0208843_100906Not Available564Open in IMG/M
Ga0208843_101120Not Available533Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208843_100336Ga0208843_1003361F003101MENRIQVANYAATLTRELCRMCRKVELDDLAYLLEVAAAEASKEPLAKRTNGSARAAIHQLSAQSS
Ga0208843_100457Ga0208843_1004571F055029GNWSLMLINHDLNAAHQVHLVIDDAKHMSHPFVGSVALVQYCNTPAEDKNITIAATPDGMYTLPAGSITVVRGKLR
Ga0208843_100618Ga0208843_1006182F081678RWLNTACQERDSSLEGLKTDFLLDPLRSDRRFAELVRKVGLPQ
Ga0208843_100758Ga0208843_1007581F041900VLEVVVRPLARQLRTPEGRRYFRIGAQLINHPRFMTDAGGAVTVNTSIARCAAYLLPSLDHLPTPVVAERTSQVTGFIIRACGDQARLMDSDPPARPVLSVEDFTVNLVDTIMAILQAPTSVASAPAAPGPDAAGG
Ga0208843_100906Ga0208843_1009061F003395CSLKAIPTSGGVTASTEMLAAKRHARVLAPVIVGKMIIANQQMAYAA
Ga0208843_101120Ga0208843_1011201F084660QNEADLLDTDLLPIRTAEGIPPAVCEAAPMAYAIVICFASCIGSSRVLELSTNRKSAPFPAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.