NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026346

3300026346: Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 C5



Overview

Basic Information
IMG/M Taxon OID3300026346 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133548 | Gp0296345 | Ga0256812
Sample NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 C5
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size47202939
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → freshwater marsh → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007982Metagenome / Metatranscriptome341Y
F014394Metagenome / Metatranscriptome263Y
F053838Metagenome / Metatranscriptome140Y
F060457Metagenome / Metatranscriptome133Y
F062283Metagenome131N
F077451Metagenome / Metatranscriptome117Y
F094061Metagenome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256812_1000511All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1209Open in IMG/M
Ga0256812_1001594All Organisms → cellular organisms → Bacteria890Open in IMG/M
Ga0256812_1003228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria731Open in IMG/M
Ga0256812_1006144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria604Open in IMG/M
Ga0256812_1006541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium594Open in IMG/M
Ga0256812_1007459Not Available570Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256812_1000511Ga0256812_10005113F014394MRGGSRVIATFVAAVVWIYAGMSVASRPVAQQAITPSVLDVAATCAIAVVD
Ga0256812_1001594Ga0256812_10015941F007982MRPAARLTLSCLVLSLLAACGAPSPPQDEAEAREKGRDTDKTVFDDMIQTEDRARAVEGVVLGQKADL
Ga0256812_1002808Ga0256812_10028082F077451PPPSTLSSIAGGLGGLFGKNSPGRWAGLAASFTELGMDLDTAKKFRPIVIDYVAHHGGENLVEKMRVALRL
Ga0256812_1003228Ga0256812_10032281F062283VVQISPPLQRSFLSLLPLLFWICKTFYADGDGGVEADNILKGLLECTGNKGGGMKQSVIFLMILTFVGPLSVFAATLQNTDSQEYELQIKEEGRPYGSYYGPYGDEFRVLEHCKTDICHYGCEMTLVSTGQKVWVNPRDEVVISYRVMKVNRAANDRRGGY
Ga0256812_1006144Ga0256812_10061441F060457DNAEPHNSSSDLGIFLSTIFHIASIACVPFLVNGTVNGNMYACGLLIVWTIYYSMRLAKSRKLLGLAFFVMILSAVVFGIYNFGLMSHYKNAKIYLEEEEIFCRETTYETLLSKYETEKSMISANFRICLDKAHVQPETCIKEVNHGTSLNEVMLSNRLLRLSNCANSLTTKQKSVDRLKHRPWVKFWLGFL
Ga0256812_1006541Ga0256812_10065411F094061QLMGEGENDVEVRGREEFGVAFFKPSLSGDVLTLGAVSIAAGVIEDTLCAAVGAALDVATQGGGAAVKEVGDDPVLIWG
Ga0256812_1007459Ga0256812_10074591F053838CGPLIAAHLGASAKPAGRALFFLGVKRNFTTAPAGDMGELVHLSH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.