Sample 3300026283

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300026283

3300026283: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_4/24/2008_ DNA (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300026283 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0055735 \| Gp0103135 \| Ga0209368
Sample Name	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_4/24/2008_ DNA (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	202807161
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
Type	Engineered
Taxonomy	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Madison, Wisconsin, USA
Coordinates	Lat. (^o)	43.076217	Long. (^o)	-89.411742	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092927	Metagenome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0209368_1078402	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	500	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209368_1078402	Ga0209368_10784022	F092927	MNCYLMKSLDTLTITEKGQAQFPASWRKQAGLMHGGPCDVRVLDDGRQSLLITPRPQKRRGAAGLLKHLESQTVAFPKVERHTMPFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.