x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016759
3300016759: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718)
Overview
Basic Information |
IMG/M Taxon OID | 3300016759 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212040 | Ga0186328 |
Sample Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718) |
Sequencing Status | Permanent Draft |
Sequencing Center | National Center for Genome Resources |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 5918753 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Location Information |
Location | Pacific Ocean |
Coordinates | Lat. (o) | 32.9 | Long. (o) | -117.255 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F059360 | Metagenome / Metatranscriptome | 134 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0186328_101237 | Ga0186328_1012371 | F059360 | MTAFSCKVLSFKMIMTLLKEVLVPANLVPAAAVIREGQALSEITGRKAFVDGIVS |