NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016759

3300016759: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718)



Overview

Basic Information
IMG/M Taxon OID3300016759 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212040 | Ga0186328
Sample NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5918753
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodymesotrophic water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)32.9Long. (o)-117.255Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059360Metagenome / Metatranscriptome134Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186328_101237Ga0186328_1012371F059360MTAFSCKVLSFKMIMTLLKEVLVPANLVPAAAVIREGQALSEITGRKAFVDGIVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.