NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011200

3300011200: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 6 - S13.3.30.a - transect 3, age 5 years, surface depth)



Overview

Basic Information
IMG/M Taxon OID3300011200 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121480 | Gp0155457 | Ga0137471
Sample NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 6 - S13.3.30.a - transect 3, age 5 years, surface depth)
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Bristol
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size16375348
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp.1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes Of Arctic Soils
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeglacial featuresoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNorway: Midre Lovenbreen, Svalbard
CoordinatesLat. (o)79.10444444Long. (o)12.27888889Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065744Metagenome127Y
F067546Metagenome125Y
F092942Metagenome / Metatranscriptome107Y
F096250Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137471_100114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium2637Open in IMG/M
Ga0137471_102497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp.975Open in IMG/M
Ga0137471_102585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium959Open in IMG/M
Ga0137471_104687Not Available699Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137471_100114Ga0137471_1001142F067546MTPVAARRAPVTVRTDDGAVVLVLSDALDHTVARVLIDAVTSAISTSPQRVDIDLRALVSWTDEGARALVACRELCRDLPDGLHYRTGRGPGREALLAAYA*
Ga0137471_102497Ga0137471_1024972F065744MQDKVNAPARPKGPNASAIVAGLVAIVLAGLIIANETTAWNVDWSALGPGAIVVVGVVLAVIGAIGLVRRHDEV*
Ga0137471_102585Ga0137471_1025852F092942MEEQHVRDRAEVLCAALVTGDIELATQDFSKELRQNLGEVLALLPLPLSEA
Ga0137471_104687Ga0137471_1046872F096250MRAGLSAWLICSTICIISLAYGQLALSAYFLALSCVVPGFVAKQLRMRSRL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.