Basic Information | |
---|---|
IMG/M Taxon OID | 3300010406 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121456 | Gp0155391 | Ga0136844 |
Sample Name | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4 |
Sequencing Status | Permanent Draft |
Sequencing Center | Illumina |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 273974 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → mine → contaminated soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Canaa dos Carajas, PA, Brazil | |||||||
Coordinates | Lat. (o) | -6.42916667 | Long. (o) | -50.06611111 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100042 | Metagenome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0136844_1130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus | 510 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0136844_1130 | Ga0136844_11302 | F100042 | KVEMARPTGVGRALATYEIPIEGRDAWLAAARRQV* |
⦗Top⦘ |