Metagenome Family F100042

Basic Information
Family ID	F100042
Family Type	Metagenome
Number of Sequences	103
Average Sequence Length	38 residues
Representative Sequence	AVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Number of Associated Samples	91
Number of Associated Scaffolds	103

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	7.07 %
% of genes near scaffold ends (potentially truncated)	86.41 %
% of genes from short scaffolds (< 2000 bps)	82.52 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Most Common Taxonomy
Group	Bacteria (86.408 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (17.476 % of family members)
Environment Ontology (ENVO)	Unclassified (19.417 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (58.252 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 17.74% β-sheet: 0.00% Coil/Unstructured: 82.26%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 103 Family Scaffolds
PF02909	TetR_C_1	10.68
PF00196	GerE	8.74
PF00126	HTH_1	7.77
PF13602	ADH_zinc_N_2	4.85
PF14329	DUF4386	3.88
PF00005	ABC_tran	2.91
PF00795	CN_hydrolase	1.94
PF08281	Sigma70_r4_2	1.94
PF13518	HTH_28	1.94
PF00773	RNB	0.97
PF00072	Response_reg	0.97
PF05117	DUF695	0.97
PF13847	Methyltransf_31	0.97
PF13426	PAS_9	0.97
PF13412	HTH_24	0.97
PF00107	ADH_zinc_N	0.97
PF00383	dCMP_cyt_deam_1	0.97
PF00440	TetR_N	0.97
PF04542	Sigma70_r2	0.97
PF00903	Glyoxalase	0.97
PF03060	NMO	0.97
PF00392	GntR	0.97
PF00058	Ldl_recept_b	0.97
PF01048	PNP_UDP_1	0.97
PF00160	Pro_isomerase	0.97
PF00563	EAL	0.97
PF00248	Aldo_ket_red	0.97
PF13229	Beta_helix	0.97
PF07883	Cupin_2	0.97
PF08240	ADH_N	0.97
PF10604	Polyketide_cyc2	0.97
PF13411	MerR_1	0.97

COG ID	Name	Functional Category	% Frequency in 103 Family Scaffolds
COG1309	DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA	Transcription [K]	10.68
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.97
COG0557	Exoribonuclease R	Transcription [K]	0.97
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.97
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.97
COG0775	Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB	Nucleotide transport and metabolism [F]	0.97
COG0813	Purine-nucleoside phosphorylase	Nucleotide transport and metabolism [F]	0.97
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.97
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.97
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.97
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.97
COG2820	Uridine phosphorylase	Nucleotide transport and metabolism [F]	0.97
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.97
COG4776	Exoribonuclease II	Transcription [K]	0.97
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.97
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.97
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.97

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.41 %
Unclassified	root	N/A	13.59 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.41 %
Unclassified	root	N/A	13.59 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.41 %
Unclassified	root	N/A	13.59 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	40.78 %
Unclassified	root	N/A	13.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.94 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.97 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	16.50 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	14.56 %
Unclassified	root	N/A	13.59 %
Candidatus Dormibacteraeota	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota	2.91 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	14.56 %
Unclassified	root	N/A	13.59 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	7.77 %
unclassified Candidatus Dormibacteraeota	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota	2.91 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.97 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.59 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	7.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Candidatus Dormibacteraeota bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	2.91 %
Chloroflexi bacterium CSP1-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	1.94 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.97 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.97 %
Geodermatophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales	0.97 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.59 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	7.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Candidatus Dormibacteraeota bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	2.91 %
Chloroflexi bacterium CSP1-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	1.94 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.97 %
Geodermatophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae	0.97 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.97 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.59 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	7.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Candidatus Dormibacteraeota bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	2.91 %
Chloroflexi bacterium CSP1-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	1.94 %
Modestobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter	0.97 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.97 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.97 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.59 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	7.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Candidatus Dormibacteraeota bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	2.91 %
Chloroflexi bacterium CSP1-4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	1.94 %
Modestobacter excelsi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter excelsi	0.97 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.97 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.97 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.97 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2067725009\|PermFrostAlaska_NODE_395_len_3744_cov_32_235577	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	3794	Open in IMG/M
2124908032\|Perma_A_C_ConsensusfromContig177445	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	618	Open in IMG/M
2124908041\|P3_CLC_ConsensusfromContig51473	All Organisms → cellular organisms → Bacteria	1276	Open in IMG/M
3300001402\|JGI20195J14853_1048531	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300001538\|A10PFW1_10398348	Not Available	1636	Open in IMG/M
3300002068\|JGIcombinedJ21913_10247565	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300002071\|JGIcombinedJ21915_10036862	All Organisms → cellular organisms → Bacteria → Proteobacteria	2170	Open in IMG/M
3300002072\|JGIcombinedJ21914_10037938	All Organisms → cellular organisms → Bacteria	1745	Open in IMG/M
3300005367\|Ga0070667_100022038	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5286	Open in IMG/M
3300005543\|Ga0070672_100043580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3461	Open in IMG/M
3300005549\|Ga0070704_100015738	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4761	Open in IMG/M
3300005836\|Ga0074470_11385922	All Organisms → cellular organisms → Bacteria → Terrabacteria group	892	Open in IMG/M
3300009029\|Ga0066793_10491149	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300009029\|Ga0066793_10499902	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	695	Open in IMG/M
3300009098\|Ga0105245_11612028	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300009098\|Ga0105245_13070821	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300010041\|Ga0126312_10453001	All Organisms → cellular organisms → Bacteria → Terrabacteria group	915	Open in IMG/M
3300010045\|Ga0126311_11319505	Not Available	600	Open in IMG/M
3300010403\|Ga0134123_10237106	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1578	Open in IMG/M
3300010406\|Ga0136844_1130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	510	Open in IMG/M
3300011994\|Ga0120157_1024174	All Organisms → cellular organisms → Bacteria	1447	Open in IMG/M
3300012001\|Ga0120167_1068570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	752	Open in IMG/M
3300012001\|Ga0120167_1085231	Not Available	655	Open in IMG/M
3300012001\|Ga0120167_1125397	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300012091\|Ga0136625_1051010	All Organisms → cellular organisms → Bacteria	1497	Open in IMG/M
3300012206\|Ga0137380_11689855	All Organisms → cellular organisms → Bacteria → Terrabacteria group	517	Open in IMG/M
3300012529\|Ga0136630_1204253	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300012530\|Ga0136635_10341809	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300012678\|Ga0136615_10057243	All Organisms → cellular organisms → Bacteria	1950	Open in IMG/M
3300012679\|Ga0136616_10322567	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300012912\|Ga0157306_10133613	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300013758\|Ga0120147_1050355	Not Available	730	Open in IMG/M
3300013772\|Ga0120158_10050176	All Organisms → cellular organisms → Bacteria	2896	Open in IMG/M
3300014259\|Ga0075311_1151139	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	532	Open in IMG/M
3300014304\|Ga0075340_1068072	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	659	Open in IMG/M
3300014322\|Ga0075355_1054319	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	904	Open in IMG/M
3300014502\|Ga0182021_10482828	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1476	Open in IMG/M
3300014502\|Ga0182021_13724569	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300014823\|Ga0120170_1022660	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1725	Open in IMG/M
3300015165\|Ga0167628_1042713	Not Available	949	Open in IMG/M
3300015373\|Ga0132257_100881742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1121	Open in IMG/M
3300018060\|Ga0187765_10133304	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1387	Open in IMG/M
3300018433\|Ga0066667_11361426	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	622	Open in IMG/M
3300019875\|Ga0193701_1067030	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300020021\|Ga0193726_1318933	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	591	Open in IMG/M
3300021078\|Ga0210381_10051468	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300021339\|Ga0193706_1030418	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1602	Open in IMG/M
3300021363\|Ga0193699_10001401	All Organisms → cellular organisms → Bacteria	9559	Open in IMG/M
3300021602\|Ga0194060_10359916	Not Available	706	Open in IMG/M
3300022534\|Ga0224452_1115235	All Organisms → cellular organisms → Bacteria	824	Open in IMG/M
3300022694\|Ga0222623_10173846	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300024245\|Ga0247677_1023247	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300025533\|Ga0208584_1090188	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	744	Open in IMG/M
3300025692\|Ga0209744_1102882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	979	Open in IMG/M
3300025692\|Ga0209744_1127618	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	844	Open in IMG/M
3300025739\|Ga0209745_1061244	Not Available	1361	Open in IMG/M
3300025764\|Ga0209539_1148766	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	905	Open in IMG/M
3300025836\|Ga0209748_1079400	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300025857\|Ga0209014_10067516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1492	Open in IMG/M
3300025857\|Ga0209014_10188646	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300025864\|Ga0209429_10385767	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300025865\|Ga0209226_10057798	All Organisms → cellular organisms → Bacteria	1767	Open in IMG/M
3300025865\|Ga0209226_10132129	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300025865\|Ga0209226_10279219	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	708	Open in IMG/M
3300025865\|Ga0209226_10381153	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300025885\|Ga0207653_10002634	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5695	Open in IMG/M
3300025888\|Ga0209540_10055647	Not Available	2439	Open in IMG/M
3300025904\|Ga0207647_10021097	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4354	Open in IMG/M
3300025941\|Ga0207711_11987541	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300026075\|Ga0207708_10019678	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5091	Open in IMG/M
3300027773\|Ga0209810_1261891	Not Available	661	Open in IMG/M
3300028784\|Ga0307282_10032374	All Organisms → cellular organisms → Bacteria	2266	Open in IMG/M
3300028802\|Ga0307503_10021310	All Organisms → cellular organisms → Bacteria	2135	Open in IMG/M
3300028802\|Ga0307503_10290857	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	815	Open in IMG/M
3300028803\|Ga0307281_10445994	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300028811\|Ga0307292_10325254	All Organisms → cellular organisms → Bacteria → Terrabacteria group	647	Open in IMG/M
3300028824\|Ga0307310_10729578	Not Available	509	Open in IMG/M
3300028861\|Ga0302259_1086156	All Organisms → cellular organisms → Bacteria → Terrabacteria group	759	Open in IMG/M
3300029987\|Ga0311334_10523715	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	955	Open in IMG/M
3300029990\|Ga0311336_10889167	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300030294\|Ga0311349_10464571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1197	Open in IMG/M
3300031511\|Ga0307424_1151084	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	734	Open in IMG/M
3300031699\|Ga0315535_1121994	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter excelsi	957	Open in IMG/M
3300031707\|Ga0315291_10926977	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300032053\|Ga0315284_11212120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	828	Open in IMG/M
3300032156\|Ga0315295_10908726	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium	878	Open in IMG/M
3300032163\|Ga0315281_10527114	All Organisms → cellular organisms → Bacteria	1253	Open in IMG/M
3300032173\|Ga0315268_10038345	All Organisms → cellular organisms → Bacteria	4588	Open in IMG/M
3300032177\|Ga0315276_12042393	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4	584	Open in IMG/M
3300032276\|Ga0316188_10877777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	500	Open in IMG/M
3300032342\|Ga0315286_11293834	All Organisms → cellular organisms → Bacteria	708	Open in IMG/M
3300032397\|Ga0315287_11026042	All Organisms → cellular organisms → Bacteria → Terrabacteria group	959	Open in IMG/M
3300032397\|Ga0315287_12385958	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	571	Open in IMG/M
3300033004\|Ga0335084_10487815	All Organisms → cellular organisms → Bacteria	1266	Open in IMG/M
3300033233\|Ga0334722_10582804	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300033482\|Ga0316627_101898825	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300033489\|Ga0299912_11027590	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300034125\|Ga0370484_0037692	All Organisms → cellular organisms → Bacteria	1170	Open in IMG/M
3300034818\|Ga0373950_0047443	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.23%
Host-Associated	Host-Associated	7.77%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	69.90%
Aquatic	Environmental → Aquatic	22.33%
Plants	Host-Associated → Plants	7.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.02%
Freshwater	Environmental → Aquatic → Freshwater	16.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.83%
Peat	Environmental → Terrestrial → Peat	3.88%
Marine	Environmental → Aquatic → Marine	2.91%
Sediment	Environmental → Aquatic → Sediment	2.91%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.46%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.65%
Lake	Environmental → Aquatic → Freshwater → Lake	10.68%
Ice	Environmental → Aquatic → Freshwater → Ice	4.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.91%
Loam	Environmental → Terrestrial → Soil → Loam	2.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.91%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.91%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.94%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.97%
Coastal	Environmental → Aquatic → Marine → Coastal	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.97%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.97%

Habitat	Taxonomy	Distribution
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	28.16%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.39%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	9.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.77%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	4.85%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.88%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.94%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.97%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.97%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.97%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.97%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.97%

Habitat	Taxonomy	Distribution
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	17.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.59%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	9.71%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	8.74%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	4.85%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.88%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	3.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.91%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.94%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.94%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.94%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	1.94%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	1.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.94%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.97%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.97%
Worm Burrow	Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow	0.97%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.97%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.97%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.97%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.97%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.97%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.97%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.97%
Wetland Sediment	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment	0.97%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.97%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.97%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.97%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.97%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2067725009	Permafrost microbial communities from central Alaska, USA - Permafrost field sample	Environmental	Open in IMG/M
2124908032	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all	Environmental	Open in IMG/M
2124908041	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3	Environmental	Open in IMG/M
3300001402	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300002068	Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)	Environmental	Open in IMG/M
3300002071	Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010)	Environmental	Open in IMG/M
3300002072	Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005)	Environmental	Open in IMG/M
3300003473	Fe-reducing enrichment culture from wetland. Sample 3 with anaerobic and aerobic cycling.	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010406	Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4	Environmental	Open in IMG/M
3300011994	Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M	Environmental	Open in IMG/M
3300012001	Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M	Environmental	Open in IMG/M
3300012091	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012529	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)	Environmental	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012678	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)	Environmental	Open in IMG/M
3300012679	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300013758	Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M	Environmental	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300014259	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1	Environmental	Open in IMG/M
3300014304	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014823	Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M	Environmental	Open in IMG/M
3300015165	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus)	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental	Open in IMG/M
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental	Open in IMG/M
3300021078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021602	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300024245	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18	Environmental	Open in IMG/M
3300025533	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025692	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)	Environmental	Open in IMG/M
3300025739	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)	Environmental	Open in IMG/M
3300025764	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)	Environmental	Open in IMG/M
3300025836	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)	Environmental	Open in IMG/M
3300025857	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)	Environmental	Open in IMG/M
3300025864	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)	Environmental	Open in IMG/M
3300025865	Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025888	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026047	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028861	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031511	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-20	Environmental	Open in IMG/M
3300031699	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032276	Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M
3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F100042

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
draft_perm_00096110	2067725009	Permafrost	EAVMARPTGVGRAISTCTIPIEGRDEWLAAARRLA
Perma_A_C_01705140	2124908032	Soil	LALPEAVMARPTGFGRPITTYTIPIQDREEWEAAARESLA
P3_CLC_01194250	2124908041	Soil	LLPEKVEMARPTGVGHALTAYRMPIEGRDEWIAAAGRRLA
JGI20195J14853_10485313	3300001402	Arctic Peat Soil	VVARPTGVGSALTAYDMPIEGRDEWVAAVARLMA*
A10PFW1_103983481	3300001538	Permafrost	TTQQVFVARPTGVGRAITAYDMPIDGRDEWLAAAARHLA*
JGIcombinedJ21913_102475651	3300002068	Arctic Peat Soil	KEWVXARPTGVGRALTAYRMPIEGRDEWIAAVERLA*
JGIcombinedJ21915_100368623	3300002071	Arctic Peat Soil	AVMARPTGVGRALTAYRMPIEGRDEWIAAVERLA*
JGIcombinedJ21914_100379381	3300002072	Arctic Peat Soil	SGDLARPEGAGRALATFEIPIEGRDEWLAAARRLA*
FeGluAir_105560791	3300003473	Wetland Sediment	VSPMSRLKTLARPTGVGSALTAYGMPIEGRDEWLAAVARLLA*
Ga0070667_1000220381	3300005367	Switchgrass Rhizosphere	VGHEAHGMAPPVTGVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA*
Ga0070672_1000435806	3300005543	Miscanthus Rhizosphere	ALPTKVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA*
Ga0070704_1000157387	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LALPTKVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA*
Ga0074470_113859223	3300005836	Sediment (Intertidal)	APPEKVAMARPTGVGRAITAYDMPIDGRDEWVAAARRLA*
Ga0066793_104911491	3300009029	Prmafrost Soil	VDMARSTGVGRAITTYDMPIEGRDEWLAAVERLA*
Ga0066793_104999023	3300009029	Prmafrost Soil	EQVFVARPTGVGSAIATYDMPIEGRDEWLAAAARHFA*
Ga0105245_116120282	3300009098	Miscanthus Rhizosphere	ALPEKVGLARPTGVGRALATYEIPIEGRDEWLAAARRLA*
Ga0105245_130708211	3300009098	Miscanthus Rhizosphere	EAVMARPTGVGRAISTYTIPIEGRDEWLAAARLGA*
Ga0126312_104530012	3300010041	Serpentine Soil	MASPILARPTGVGRALATYEIPIEGRDEWLAAARRLA*
Ga0126311_113195053	3300010045	Serpentine Soil	MSYDTGRVVMARPTGVGRALTTHDILIERRDEWLAAARRLA*
Ga0134123_102371064	3300010403	Terrestrial Soil	MALPVTGVMARPTGVGRTISTYTIPIEGRDEWLAAARRLA*
Ga0136844_11302	3300010406	Soil	KVEMARPTGVGRALATYEIPIEGRDAWLAAARRQV*
Ga0120157_10241741	3300011994	Permafrost	VFVALPTGVGRALATYEIPIEGRDEWLGAARGLAGGLA
Ga0120167_10685702	3300012001	Permafrost	PEKVVMARPTGVGHALTAYRMPIEGRDEWIAAARRLA*
Ga0120167_10852312	3300012001	Permafrost	QQVFVARPTGAGRAITAYDMPIDGRDEWLAAAARHLA*
Ga0120167_11253971	3300012001	Permafrost	FVMARPTGVGRAITTYNMPIDGRDEWLAAAARHLA*
Ga0136625_10510104	3300012091	Polar Desert Sand	EKVAMARPTGVGRALTAYRMPIEGRDEWLASVERLA*
Ga0137380_116898551	3300012206	Vadose Zone Soil	VAFVRPSGLGRAISTFDIPIEGRDEWLAAARRLA*
Ga0136630_12042532	3300012529	Polar Desert Sand	ALPEKVEMARPTGVGHALTAYRMPIEGRDEWIAAAGRRLA*
Ga0136635_103418091	3300012530	Polar Desert Sand	KVEMARPTGVGRALTAFHIPIEGRDEWIAAARRLA*
Ga0136615_100572431	3300012678	Polar Desert Sand	SPGLVRRVKAAITRPTGVGSATTAISMPIEGRDEWLAAARRLA*
Ga0136616_103225673	3300012679	Polar Desert Sand	PDAVMARLTGVGRAITTYDMPIEGRDEWLAAARRLA*
Ga0157306_101336131	3300012912	Soil	REMARPIGVGRAISTYTIPIEGRDEWLAAARRLA*
Ga0120147_10503551	3300013758	Permafrost	VQPAQEWVLARPTGLGTTITTYEIPIEGRDEWLAAARQLA*
Ga0120158_100501761	3300013772	Permafrost	QQVFVARPTGVGRAITAYDMPIDGRDEWLAAAARHLA*
Ga0075311_11511392	3300014259	Natural And Restored Wetlands	MALACPTGVGRAIATYEIPIEGRDEWLAAARRLA*
Ga0075340_10680721	3300014304	Natural And Restored Wetlands	LALPEKVELARPTGVGRALATYEILIEGRAEWLAAARRLA*
Ga0075355_10543193	3300014322	Natural And Restored Wetlands	LALPEKVVLARPTGVGSALTAYGMPIEGRDEWLAAVARLLA*
Ga0182021_104828281	3300014502	Fen	LPEKVAVARPTGVGRAITTYDMPIEGRDEWVAAARRLA*
Ga0182021_137245691	3300014502	Fen	RWGVMARPTGVGRALTAYRMPIEGRDEWIAAVERLA*
Ga0120170_10226601	3300014823	Permafrost	AEARVWVARPEGVGRALATYRVPIEGRDEWIAAAERLA*
Ga0167628_10427132	3300015165	Glacier Forefield Soil	GRRALFVVSKPMPVGRALATFEIPIEGRDEWLAAARRLA*
Ga0132257_1008817423	3300015373	Arabidopsis Rhizosphere	AVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA*
Ga0187765_101333041	3300018060	Tropical Peatland	LVEVARPAGFGHALATCEIPIEGRDEWLAAAGLSA
Ga0066667_113614262	3300018433	Grasslands Soil	MELPDKVEMARPTGVGRALATYTIPIEGRDEWLAAAGLRA
Ga0193701_10670303	3300019875	Soil	PAQEWVLARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0193726_13189331	3300020021	Soil	CPIRLKMARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0210381_100514683	3300021078	Groundwater Sediment	PPLRLARPTGVGRAISTCTIPIEGRDEWLAAARRLA
Ga0193706_10304181	3300021339	Soil	SRCPKRLKWRARQVVGRALATCEIPIEGRDEWLAAAGLTA
Ga0193699_100014016	3300021363	Soil	MSRGGALARPTGVGGAIATYTIPIEGRDEWLAAARRLA
Ga0194060_103599161	3300021602	Anoxic Zone Freshwater	TQADEMARPTGVGLALATCDLAIEGRDEWLAAARRLA
Ga0224452_11152351	3300022534	Groundwater Sediment	EVAVARPTGVGRAISTCTIPIEGRDEWLAAARRLA
Ga0222623_101738461	3300022694	Groundwater Sediment	PEEVAVARPTGVGRAISTCTIPIEGRDEWLAAARRLA
Ga0247677_10232471	3300024245	Soil	KGVLARLTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0208584_10901881	3300025533	Arctic Peat Soil	KEWVLARPTGVGRALTAYRMPIEGRDEWIAAVERLA
Ga0209744_11028823	3300025692	Arctic Peat Soil	LALVLPQVVMARPTGVGHALTAYRMPIEGRDEWIAAVERLA
Ga0209744_11276181	3300025692	Arctic Peat Soil	RAIGHLARPTGVGSALTAYDMPIEGRDEWLAAVARLLA
Ga0209745_10612442	3300025739	Arctic Peat Soil	SPVARSKGVGRAIAAYDMLIEGRDEWLAAAARHLA
Ga0209539_11487661	3300025764	Arctic Peat Soil	ALPEKVEMARPTGVGRGITTYTIPIDGRDEWLAAARRLA
Ga0209748_10794001	3300025836	Arctic Peat Soil	EVVMARPTGVGRAITAYDMPIEGRDEWLAAAARHFA
Ga0209014_100675164	3300025857	Arctic Peat Soil	LAMPEKVAMARPTGVGRALTAYRMPIEGRDEWIAAVERLA
Ga0209014_101886461	3300025857	Arctic Peat Soil	EQVFVARPTGVGRALTAYRMPIEGRDEWIAAVERLA
Ga0209429_103857671	3300025864	Arctic Peat Soil	AAMARPTGVGRAIPTYDMPIEGRDEWLAAAARHLA
Ga0209226_100577981	3300025865	Arctic Peat Soil	RKRAALARPEGAGRALATCEIPIEGRDEWVAAARRLA
Ga0209226_101321293	3300025865	Arctic Peat Soil	LPEIVVSVRPTSVGHALTTCTILIEGRDEWIAAAGERSA
Ga0209226_102792193	3300025865	Arctic Peat Soil	VLPEQAAMARPTGVGRAITAYDMPIEGRDEWLAAAARHFA
Ga0209226_103811531	3300025865	Arctic Peat Soil	LALPDAVMARPTGVGHALTAYRMPIEGRDEWIAAVERLA
Ga0207653_100026341	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	LPVTGVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0209540_100556474	3300025888	Arctic Peat Soil	AMPDKVAMARPTGVGHALTAYRMPIEGRAEWIAAVERLA
Ga0207647_100210971	3300025904	Corn Rhizosphere	VLPEKVAVARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0207711_119875411	3300025941	Switchgrass Rhizosphere	ERVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0208658_10221861	3300026047	Natural And Restored Wetlands	VSLMSRLMTLARPTGVGHAISTYTIPIDGRDEWIAAARRQA
Ga0207708_100196788	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	AIGFSRSRDALARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0209810_12618911	3300027773	Surface Soil	PMAWRARTGVGRALATYEIPIEGPDECLAAARRLA
Ga0307282_100323742	3300028784	Soil	MTSELRMRQKVAMARPTGVGRALATYTIPIEGRDEWLAAARRLA
Ga0307503_100213101	3300028802	Soil	TEVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0307503_102908571	3300028802	Soil	KKCHGAPTGVGRALATYEIPIEGRDEWLAAARRLA
Ga0307281_104459941	3300028803	Soil	TFVLARPTGVGRAITAYRMPIEGRDEWVAAARRLA
Ga0307292_103252542	3300028811	Soil	PGARVIVVLARPTGVGRAITTYSIPIEGRDEWIAAAERLA
Ga0307310_107295782	3300028824	Soil	MVNRERRPSSVLARPTGVGRAISTYTISIEGRDEWLAAAG
Ga0302259_10861562	3300028861	Fen	KVAVARPTGVGRALATCEIPIEGRDEWLAAAWLATA
Ga0311334_105237151	3300029987	Fen	LALPQAVMARPTGVRRAIATCEIPIEGRDEWLAAARRLA
Ga0311336_108891672	3300029990	Fen	MKAGILARPTGVGPAISTYNIPIEGRDEWLAAAGLPA
Ga0311349_104645712	3300030294	Fen	RWRCPKIVAMARPTGGGRAISTYELLIEGRDEWLAAARRLA
Ga0299906_106004453	3300030606	Soil	TLPEAVMSRLMTMARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0302046_101348841	3300030620	Soil	VSPMSRLMTMARPTGVGRAISTYTIPIEGRDEWLAAARRLA
Ga0307424_11510842	3300031511	Salt Marsh	LARPTVARPTGVGRALATYEIPIEGRDEWLAAARRLA
Ga0315535_11219941	3300031699	Salt Marsh Sediment	TSVLARPTGVGRALATYEIPIEGRDEWLAAARRLA
Ga0315291_109269773	3300031707	Sediment	LHDGLARPEGSGRALATCEIPIEGRDEWIAAAEGWA
Ga0315284_112121201	3300032053	Sediment	PQVVMARPEGFGRALATYELPIEGRDEWLAAARRLA
Ga0315295_109087261	3300032156	Sediment	RRNLARPEGSGRALATYEVPIEGRDEWIAAARHLA
Ga0315281_105271141	3300032163	Sediment	ALPEKAVLARPTGVGHALTAYEIPIEGRDEWLAAARRRA
Ga0315268_100383451	3300032173	Sediment	LPRQVEMARLTGVGRALATYEIPIEGRDEWLAAARRLA
Ga0315276_120423932	3300032177	Sediment	PERVVMARPEGVGRALATYEIPIEGRDEWLAAARRLA
Ga0316188_108777771	3300032276	Worm Burrow	PDKVAVARPEDVGRAIATYEIPIEGRDEWLTAAGIVGA
Ga0315286_112938342	3300032342	Sediment	LPEEGVMARPTGVGRAITTCSMSIEGRDEWLAAAVRHLA
Ga0315287_110260421	3300032397	Sediment	LPERVVMARPEGVGRALATYEIPIEGRDEWLAAARRLA
Ga0315287_123859582	3300032397	Sediment	TDVLARPTGVGRALATYEIPIEGRDEWLAAARRLA
Ga0335084_104878152	3300033004	Soil	MERMSMARPTGVGRAISTYTIPIEGRDEWLAAARLLA
Ga0334722_105828043	3300033233	Sediment	LPEAVMARPTGVGRAITTYTLPIEGRDEWLVAAGRRA
Ga0316627_1018988253	3300033482	Soil	KVEMARPTGVGRAISTCTIPIEGRDEWLAAARRLA
Ga0299912_110275903	3300033489	Soil	RTFDLETMALARPTGVGHALTTHRIPIEGRNEWIAAARRLA
Ga0370484_0037692_1043_1168	3300034125	Untreated Peat Soil	ALARPGPVVMARLTGVGRAISTCTIPIEGRDEWLAAARRLA
Ga0373950_0047443_718_837	3300034818	Rhizosphere Soil	ELPEEVVLARPTGVGRAISTYTIPIEGRDEWLAAARRLA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign