| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007051 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117429 | Gp0123708 | Ga0102624 |
| Sample Name | Combined Assembly of 100bp T18 (BES) Gp0123708, Gp0123962, Gp0123963 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 81760464 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 2 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | UK | |||||||
| Coordinates | Lat. (o) | 54.971158 | Long. (o) | -1.703654 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020363 | Metagenome / Metatranscriptome | 224 | Y |
| F045728 | Metagenome / Metatranscriptome | 152 | Y |
| F048390 | Metagenome / Metatranscriptome | 148 | Y |
| F091072 | Metagenome / Metatranscriptome | 108 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102624_104746 | Not Available | 2256 | Open in IMG/M |
| Ga0102624_116140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 855 | Open in IMG/M |
| Ga0102624_123706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 665 | Open in IMG/M |
| Ga0102624_127748 | Not Available | 604 | Open in IMG/M |
| Ga0102624_134401 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 533 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102624_104746 | Ga0102624_1047461 | F020363 | NKRAEIGAHLDCRLDFFTDNALPLLALTFGGMCSWRRVAVARVFALVMRCRVKRLLLYSRVGKNRDTSRESPAAAGAGRTTDHLIVLFSQKVLAVRKANCIYRPVSHS* |
| Ga0102624_116140 | Ga0102624_1161403 | F045728 | HLTGRYMQLASAPRESSGQNERPSMAVQAAPAAAGDSLLVSRFLPTRE* |
| Ga0102624_123706 | Ga0102624_1237061 | F045728 | MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRFLPTRE |
| Ga0102624_127748 | Ga0102624_1277481 | F048390 | ILYYYGSNMVRFVRTLQHRVTPQGRDFYALSIPPQVAEALELKDGGQVSICVNPVKKGKFEITLKPASCDNINP* |
| Ga0102624_134401 | Ga0102624_1344011 | F091072 | MAGTVKETIAPICEETEEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDDFLD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |