


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004383 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114287 | Gp0110139 | Ga0064591 |
| Sample Name | Marine microbial communities from Bothnian Bay, Baltic Sea |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Gottingen |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 58161824 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 7 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1 |
| All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1 |
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Bothnian Bay, Baltic Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Marine Microbial Communities From Bothnian Bay, Baltic Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bothnian Bay, Baltic Sea | |||||||
| Coordinates | Lat. (o) | 65.4530556 | Long. (o) | 23.3088889 | Alt. (m) | N/A | Depth (m) | 75 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010462 | Metagenome / Metatranscriptome | 303 | Y |
| F015265 | Metagenome / Metatranscriptome | 256 | Y |
| F034973 | Metagenome / Metatranscriptome | 173 | Y |
| F045581 | Metagenome / Metatranscriptome | 152 | Y |
| F052406 | Metagenome | 142 | Y |
| F081252 | Metagenome | 114 | Y |
| F095347 | Metagenome / Metatranscriptome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0064591_10006469 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 652 | Open in IMG/M |
| Ga0064591_10015517 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1008 | Open in IMG/M |
| Ga0064591_10039867 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1038 | Open in IMG/M |
| Ga0064591_10039926 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 547 | Open in IMG/M |
| Ga0064591_10088528 | Not Available | 865 | Open in IMG/M |
| Ga0064591_10384213 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0064591_10006469 | Ga0064591_100064692 | F015265 | MFPDFITKSSTMYPAHITKNPALIEKNAIVNLNNVGLPVFRNPINDIIPIESPTKNPIKLSIFSNRNSNDD* |
| Ga0064591_10015517 | Ga0064591_100155172 | F081252 | MLTPRLTTYPACATVTALLIDIDCRLTELASTLYNNIIYSLNQTIPAEAIMDLLNYKRILMYKFCNSDYAPCFTVEMIASRVKLLKYK* |
| Ga0064591_10039867 | Ga0064591_100398673 | F095347 | IFMYLQAAKSKVEFCLEPQKGMSLYNYALKLLNKMECTNC* |
| Ga0064591_10039926 | Ga0064591_100399261 | F010462 | MLYQLPNGKVVHLSIEEYLSLTDLDIQFLMSIDYGEHILDPFTGSAVEKNTREKYIDTDFLPLEDYDLNDIPSDDLPFDDIIDLQDPLDN* |
| Ga0064591_10088528 | Ga0064591_100885281 | F052406 | MKRVDIFSINASDKTALMQMQTKLNQWLTAKSLVKYEIHTTGEYII |
| Ga0064591_10188363 | Ga0064591_101883631 | F034973 | MSVLKSKTSLKKAPKVPPPKPINGNYMKEADTKLRLKSPQWPMKQKRLSK* |
| Ga0064591_10384213 | Ga0064591_103842131 | F045581 | MNLQISTGSNELDNFYKKDFYFSYSSINKLLFSPRMFYNHYVLKQKEDSTDSHLVIGRVLHCLLLEPANFDNQFAVMTSKIPSENNKKIIDNIFRNYLVNQNNTLTLEDYSKDILTHLLT |
| ⦗Top⦘ |