| Basic Information | |
|---|---|
| Family ID | F095347 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 94.29 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.905 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03382 | DUF285 | 0.95 |
| PF01391 | Collagen | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.90 % |
| All Organisms | root | All Organisms | 18.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.38% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 10.48% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.86% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.90% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.95% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.95% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.95% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.95% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.95% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.95% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.95% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.95% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2020350001 | Viral communities in wastewater treatment process (AD) | Engineered | Open in IMG/M |
| 3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004383 | Marine microbial communities from Bothnian Bay, Baltic Sea | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019750 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MG | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020495 | Freshwater microbial communities from Lake Mendota, WI - 20APR2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AD_485910 | 2020350001 | Wastewater | MYIEAAKAKVEICLEPSKGMELYGYAKKLLSNLIVHLVSNY |
| BS_KBB_SWE26_205mDRAFT_10536943 | 3300000126 | Marine | IFMYLQAAKSKVEFCHEPQKGMSLYNYALKLLNKLECTHC* |
| JGI12421J11937_101424971 | 3300000756 | Freshwater And Sediment | EKLEALRIIRMYLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMDCVNC* |
| JGI24766J26685_100867171 | 3300002161 | Freshwater And Sediment | MYLEAAXSKVEFCHEPQKGMSLYNYALKLLNKMDCINC* |
| B570J29032_1089425471 | 3300002408 | Freshwater | MYLEAAKAKVEFCHEPQKGMSLYNYALKMLNKLDCVNC* |
| B570J40625_1005856891 | 3300002835 | Freshwater | IKMYLESAKSKVEFCHEPQKGMSLYNYALKLLNKFECNNC* |
| B570J40625_1017089311 | 3300002835 | Freshwater | EALRIIRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC* |
| Ga0064591_100398673 | 3300004383 | Marine Sediment | IFMYLQAAKSKVEFCLEPQKGMSLYNYALKLLNKMECTNC* |
| Ga0068876_101140663 | 3300005527 | Freshwater Lake | LQAAKSKVEFCLEPQKGMSLYNYAVKLLNKMECKNC* |
| Ga0049083_100691943 | 3300005580 | Freshwater Lentic | LRIIRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC* |
| Ga0078894_110864643 | 3300005662 | Freshwater Lake | LKMAKMYLDAAKAKVEFCHEPNHGMSLYNYALKIMNKLDCKNC* |
| Ga0098073_10466082 | 3300006734 | Marine | LDELRKVRMYLEAAQAAVETCHEAQKGMTLYNYAIKILNKLDCKNC* |
| Ga0070750_103685432 | 3300006916 | Aqueous | IKSYLDAAVAKVETCHEVQKGMSLYNYAIKLLNKLECKNC* |
| Ga0102945_10001631 | 3300007609 | Pond Water | IRTYLDAAKAKVEYCHEPQKGMTLYNYAIKLLNKLDCINC* |
| Ga0099850_10881633 | 3300007960 | Aqueous | IKMYLDAAKAKVETCHENQEGMTLFNYAVKLLNKLDCRNC* |
| Ga0114363_12260981 | 3300008266 | Freshwater, Plankton | YLEAAKAKVEFCHDPQKGMTLYNYALKMLNKLDCVNC* |
| Ga0114918_101090081 | 3300009149 | Deep Subsurface | QSAKSKVEYCLEPQKGMSLYNYALKLLNKLDCINC* |
| Ga0114918_105709133 | 3300009149 | Deep Subsurface | MYLEAAKGKVEFCHEPQKGMSLYNYAWKLLNKMDCVNC* |
| Ga0105104_102531501 | 3300009168 | Freshwater Sediment | LINMYLQAAKAKVEYCHEPQKGMSLYNYALKLLNKLTCTNC* |
| Ga0129333_116590493 | 3300010354 | Freshwater To Marine Saline Gradient | LRMIKMYLEAAKAKVEYCLEPQKGMSLYNYAIKLLNKFECINC* |
| Ga0136709_10314921 | 3300011184 | Freshwater | LQAAKSKVETCHEPQKGMSLYNYAMKLLKKLSCINC* |
| Ga0153916_125267621 | 3300012964 | Freshwater Wetlands | TKQKLEQLGLIKMYLEAAKAKVEFCHDPQKGMTLYNYALKMLNKLDCVNC* |
| Ga0164292_103168061 | 3300013005 | Freshwater | TKQRLEALGLIKMYLEAAKAKVEYCHEPQKGMSLYNYALKLLNKLDCVNC* |
| (restricted) Ga0172372_105571431 | 3300013132 | Freshwater | LDAAKAKVEVCHEPQEGMQLYNYALKLLNKMECRTCK* |
| (restricted) Ga0172371_106881463 | 3300013138 | Freshwater | AAKAKIETCHLSQEGMTLFNYAVKLLNKFECKNC* |
| Ga0177922_111901061 | 3300013372 | Freshwater | ALRLIFMYLQSAKSKVEYCLEPQKGMSLYNYALKLLNKLDCINC* |
| Ga0181350_10109273 | 3300017716 | Freshwater Lake | LEALRIIRMYLDAAKAKVEVCHEPQKGMSLYNYALKLLMKM |
| Ga0181350_10173543 | 3300017716 | Freshwater Lake | LQSAKSKVEYCHEPQKGMSLYNYALKLLNKLDCINC |
| Ga0181350_11537523 | 3300017716 | Freshwater Lake | LEALRLIFMYLQSAKSKVEYCHEPQKGMSLYNYALKLLNKLSCTNC |
| Ga0181343_10942813 | 3300017766 | Freshwater Lake | MAKMYLDAAKAKVEFCHEPNHGMSLYNYALKIMNKLDCKNC |
| Ga0181358_10474611 | 3300017774 | Freshwater Lake | KLEALRIIRMYLDAAKAKVEVCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0181349_12491371 | 3300017778 | Freshwater Lake | EALRIIRMYLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMDCVNC |
| Ga0181355_13710213 | 3300017785 | Freshwater Lake | IKMYLEAAKAKVEYCHDPQKGMTLYNYALKLLNKLDCVNC |
| Ga0181424_103056531 | 3300017786 | Seawater | KLEQLHLIRMYLEAAKAKVEYCHEPQKGMTLYNYACKQLDRMNCTNC |
| Ga0194000_10744531 | 3300019750 | Sediment | TCEPGSETEKKLDTLRKIRMYLDAAKAKVEVCHEPRKGLELYKYAVKLLNKFECKSCQNY |
| Ga0181360_1052271 | 3300019781 | Freshwater Lake | MYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Ga0181360_1112413 | 3300019781 | Freshwater Lake | YLDAAKAKVEFCHDPQKGMTLYNYALKLLNKFECKNC |
| Ga0181361_1063183 | 3300019783 | Freshwater Lake | RAAKGKVEFCHEPQKGMSLYNYAWKLLNKMDCVNC |
| Ga0181359_10386661 | 3300019784 | Freshwater Lake | LIKMYLEAAKAKVEFCHEPQKGMSLYNYALKMLNKLDCVNC |
| Ga0207193_12609792 | 3300020048 | Freshwater Lake Sediment | TKLDKLREIKSYLEAAKAKVEDCHEPKKGMMLYDYAVKLLNKMDCVNC |
| Ga0207193_14837242 | 3300020048 | Freshwater Lake Sediment | MYLESAKSKVEFCHEPQKGMSLYNYALKLLNKFECNNC |
| Ga0211733_100461933 | 3300020160 | Freshwater | EKLEALRLIFMYLQSAKSKVEYCLEPQKGMSLYNYALKLLNKLDCINC |
| Ga0211729_110544181 | 3300020172 | Freshwater | KMYLESAKSKVEFCHESQKGMSLYNYALKLLNKFECNNC |
| Ga0208720_10291621 | 3300020495 | Freshwater | LINMYLQAAKAKVEYCHEPQKGMSLYNYALKLLNKLTCTNC |
| Ga0208485_10554203 | 3300020573 | Freshwater | IKMYLDAAKSKVEFCHEPQKGMSLYNYALKLLKKMDCVNC |
| Ga0206681_104374851 | 3300021443 | Seawater | GMYLENAKAKVETCHEQQEGMTLYNYALKLLNKLDCRNC |
| Ga0181354_10407651 | 3300022190 | Freshwater Lake | IIRMYLDAAKSKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0196905_11336453 | 3300022198 | Aqueous | KIRMYLDAAKAKVEICHEPRKGMELYKYAVKLLNKFECKSCQNY |
| Ga0224495_103436271 | 3300022208 | Sediment | DAAKAKVEFCHEAQQGMTLYNYAIKLLNKFDCKTC |
| Ga0181351_10769903 | 3300022407 | Freshwater Lake | EEKLEALRIIRMYLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0210003_11942373 | 3300024262 | Deep Subsurface | QSAKSKVEYCLEPQKGMSLYNYALKLLNKLDCINC |
| Ga0255243_11833671 | 3300024569 | Freshwater | LIKMYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKLDCINC |
| Ga0209616_10171673 | 3300025091 | Freshwater | LQAAKSKVETCHEPQKGMSLYNYAMKLLKKLSCINC |
| Ga0208158_10768521 | 3300025110 | Marine | MYLEAAKAKVEYCHEPQKGMTLYNYACKLLGKMNCTNC |
| Ga0208161_10029058 | 3300025646 | Aqueous | IKMYLDAAKAKVETCHENQEGMTLFNYAVKLLNKLDCRNC |
| Ga0208767_11167873 | 3300025769 | Aqueous | TLLDAAKAAVEYCHEPTKGMDIYNYAVKLLDKINCVTC |
| Ga0208974_10221741 | 3300027608 | Freshwater Lentic | LDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0209819_103519693 | 3300027722 | Freshwater Sediment | KLESLRMIRMYLDAAKAKVEFCHEPQKGMSLYNYAMKLLSKFECSNC |
| Ga0209355_10051655 | 3300027744 | Freshwater Lake | LRIIRMYLDAAKSKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0209134_101960001 | 3300027764 | Freshwater Lake | RLIRMYLEAAKAKVEYCLEPDKGMTIYNYALKLLNKLDCKNC |
| Ga0209246_103866761 | 3300027785 | Freshwater Lake | DAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0209353_100335051 | 3300027798 | Freshwater Lake | RMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0209353_102543491 | 3300027798 | Freshwater Lake | KMYLEAAKAKVEYCHEPQKGMSLYNYALKLLNKLDCVNC |
| Ga0209990_100983573 | 3300027816 | Freshwater Lake | LERLRIIRMYLDAAKAKVEFCQEPQKGMTLYNYAIKLLNKFECKTC |
| Ga0209668_100695931 | 3300027899 | Freshwater Lake Sediment | LESAKSKVEFCHEPQKGMSLYNYALKLLNKFECNNC |
| Ga0209668_107265731 | 3300027899 | Freshwater Lake Sediment | LIRMYLEAAKAKVEYCLEPDKGMTIYNYALKLLNKLDCKKC |
| Ga0209191_13348211 | 3300027969 | Freshwater Lake | QSAKSKVEYCHEPQKGMSLYNYALKLLNKLDCINC |
| Ga0209401_12769983 | 3300027971 | Freshwater Lake | IRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| (restricted) Ga0247834_10942323 | 3300027977 | Freshwater | LQAAKSKVEFCHEPQKGMSLYNYALKLLNKMECRNC |
| (restricted) Ga0233414_100324402 | 3300028045 | Seawater | YLEAAKSKVETCHEQQEGMTLYNYALKLLNKLDCRNC |
| (restricted) Ga0247832_12067163 | 3300028557 | Freshwater | QAAKSKVEFCHEPQKGMSLYNYALKLLNKMECRNC |
| Ga0307380_101586471 | 3300031539 | Soil | IRMYLDAAKSKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0307380_107539671 | 3300031539 | Soil | LGLIRMYLEAAKSKVEFCHEPQKGMSLYNYAWKLLNKMDCINC |
| Ga0307378_101209521 | 3300031566 | Soil | YLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMDCVNC |
| Ga0307378_107383353 | 3300031566 | Soil | QRLEELRLIFMYLQAAKSKVEFCLEPQKGMSLYNYALKLLNKMECTNC |
| Ga0307378_111520843 | 3300031566 | Soil | KLEALRIIRMYLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0307378_112180301 | 3300031566 | Soil | LEELGLIRMYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Ga0307376_103301583 | 3300031578 | Soil | RLIFMYLQAAKSKVEFCLEPQKGMSLYNYALKLLNKMECTNC |
| Ga0307376_103358691 | 3300031578 | Soil | QRLEELNFIKMYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Ga0307375_103047311 | 3300031669 | Soil | ELNFIKMYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Ga0307375_104629121 | 3300031669 | Soil | AAKAKVEVCHEPLKGMELFNYAVKLLDKIECKSCMKS |
| Ga0307375_105710011 | 3300031669 | Soil | EELNFIKMYLEAAKSKVEFCHEPQKGMSLYNYALKLLNKMDCINC |
| Ga0315293_100875961 | 3300031746 | Sediment | IIRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0315293_101610011 | 3300031746 | Sediment | IIRMYLDAAKSKVEVCHEPQKGMSLYNYALKLLMKMDCVNC |
| Ga0315907_111637501 | 3300031758 | Freshwater | LEAAKAKVEYCHESQKGMSLYNYAIKLLNKFDCINC |
| Ga0315900_109481683 | 3300031787 | Freshwater | LEAAKAKVEFCHEPQKGMSLYNYALKMLDKLECKNC |
| Ga0315900_110952703 | 3300031787 | Freshwater | RVQQRMEKLRMIKSYLEAAKAKVENCHEPQKGMSLYNYAIKLLNKYDCVNC |
| Ga0315904_102858373 | 3300031951 | Freshwater | EKLRMVRMYLDAAKAKVEFCHEPQKGMTLYNYAIKLLNKLDCVNC |
| Ga0315904_105163321 | 3300031951 | Freshwater | IKMYLEAAKAKVEYCHESQKGMSLYNYAIKLLNKFDCINC |
| Ga0315904_105462763 | 3300031951 | Freshwater | TLRLIFMYLQAAKSKVEFCHEPQKGMALYNYALKLLNKLSCTNC |
| Ga0315294_103930033 | 3300031952 | Sediment | RIIRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0315906_110727691 | 3300032050 | Freshwater | QAAKSKVEFCHEPQKGMALYNYALKLLNKLSCTNC |
| Ga0315284_112116843 | 3300032053 | Sediment | LEALRLINMYLQAAKAKVEYCHEPQKGMSLYNYALKLLNKLTCTNC |
| Ga0315277_103883821 | 3300032118 | Sediment | EKLEALRIIRMYLDAAKSKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0315277_116733003 | 3300032118 | Sediment | NFSFNMYLEAAKAKVEFCHEPLEGMQLFNYAVLLLNKMECRTCK |
| Ga0315270_100516451 | 3300032275 | Sediment | LKMAKMYLDAAKAKVEFCHEANQGMSLYNYAVKLMKKINCKSC |
| Ga0315273_129250311 | 3300032516 | Sediment | ALRLIRMYLDAAKAKVEFCHEPQKGMSLYNYALKLLMKMECVNC |
| Ga0335005_0244740_2_109 | 3300034022 | Freshwater | DAAKAKVEFCHEPTHGMTLYNYALKIMRKIECKNC |
| Ga0335021_0273265_741_872 | 3300034023 | Freshwater | LREIKSYLEAAKAKVEDCHEPKKGMMLYDYAVKLLNKMDCVNC |
| Ga0334983_0199589_1114_1242 | 3300034060 | Freshwater | RLINMYLQAAKAKVEYCHEPQKGMSLYNYALKLLNKLTCTNC |
| Ga0334987_0034393_1_126 | 3300034061 | Freshwater | FIKMYLDAAISKVEFCHEPQKGMSLYNYALKLLNKMTCTNC |
| Ga0335031_0180204_2_109 | 3300034104 | Freshwater | EAAKGKVEFCHEPQKGMSLYNYAWKLLNKMDCVNC |
| Ga0335063_0550860_19_135 | 3300034111 | Freshwater | MYLEAAKAKVEICHKSQEGMTLFNYAVKLLNKLDCKNC |
| Ga0335054_0210278_1060_1170 | 3300034119 | Freshwater | LQAAKAKVEYCHEPQKGMSLYNYALKLLNKLTCTNC |
| Ga0335054_0612194_1_111 | 3300034119 | Freshwater | LDAAKAKIETCHLSQEGMTLFNYAVKLLNKFECKNC |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |