| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004340 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110188 | Gp0091629 | Ga0066239 |
| Sample Name | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4A |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 39295924 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | mangrove biome → intertidal zone → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sao Paulo State, Brazil | |||||||
| Coordinates | Lat. (o) | -23.8553 | Long. (o) | -46.1394 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001758 | Metagenome / Metatranscriptome | 640 | Y |
| F043157 | Metagenome / Metatranscriptome | 157 | Y |
| F055469 | Metagenome / Metatranscriptome | 138 | Y |
| F088984 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0066239_1005991 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 614 | Open in IMG/M |
| Ga0066239_1006710 | Not Available | 591 | Open in IMG/M |
| Ga0066239_1006735 | Not Available | 590 | Open in IMG/M |
| Ga0066239_1009286 | Not Available | 529 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066239_1005991 | Ga0066239_10059911 | F088984 | MAFERSPSIRLWWAHVTVTPEASRTAVFRRGTLNGLIGVIPTGGQQHPSSGVGARLLWKKAQKKAKKKHTSEIIKRTIPHRKPLATYEV* |
| Ga0066239_1006710 | Ga0066239_10067102 | F001758 | ERLGQAGWLNPSKAESKGKVEEAGFTSSSGGVRAPSVTRSVELNGEER* |
| Ga0066239_1006735 | Ga0066239_10067352 | F043157 | IFDERFRDCICLNIYDRIDGMQMPGESIMIKMAKGLERRIS* |
| Ga0066239_1009286 | Ga0066239_10092861 | F055469 | MLKRTVVILAAAAFFGGTVPTQTAQARDDMWDLMNPSWWADQIFDDDDDDWWYYRHHAYNPYWGAPQVQRPRVIVIQSPETVAQNPEIRLPE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |