NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004338

3300004338: Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1A



Overview

Basic Information
IMG/M Taxon OID3300004338 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0110188 | Gp0091618 | Ga0066227
Sample NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC1A
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size37386752
Sequencing Scaffolds11
Novel Protein Genes11
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Atkinsviridae2
Not Available5
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces avermitilis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)mangrove biome → intertidal zone → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006508Metagenome / Metatranscriptome371Y
F008255Metagenome / Metatranscriptome336Y
F014854Metagenome / Metatranscriptome259Y
F014988Metagenome / Metatranscriptome258Y
F028190Metagenome / Metatranscriptome192Y
F035541Metagenome / Metatranscriptome172Y
F043157Metagenome / Metatranscriptome157Y
F048649Metagenome / Metatranscriptome148Y
F055278Metagenome / Metatranscriptome139Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066227_1000054All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Atkinsviridae2672Open in IMG/M
Ga0066227_1000091All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Atkinsviridae2362Open in IMG/M
Ga0066227_1001260Not Available1035Open in IMG/M
Ga0066227_1002127Not Available869Open in IMG/M
Ga0066227_1003179All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae754Open in IMG/M
Ga0066227_1004668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi657Open in IMG/M
Ga0066227_1004809Not Available651Open in IMG/M
Ga0066227_1004853Not Available649Open in IMG/M
Ga0066227_1006747Not Available579Open in IMG/M
Ga0066227_1009494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces avermitilis514Open in IMG/M
Ga0066227_1009975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066227_1000054Ga0066227_10000542F014988MAITVSSPVTGAAITGLSSPTYTLVTDTAPGAGKQYAVTALGGTQTGVEAHSVSKPFTLSAFRPGTLRVLPGANPVTGVIKNVPVNTYKVITRKGAAPAANQPNVVARVTTVLDIPAGTDSYSPAELKAMLSLHFGALTDMADGIADTALTGIL*
Ga0066227_1000091Ga0066227_10000912F014988MAFAPSSPITGATVAGLTSPTYTHVTDVAPSINGKQFAVTALGGTQTGVDVNSVSKPFTISFFKPVVLKVLPQANPVTGVIKNVPMNTYKLITRKGVQPAANQNNMTARITTIIEVPAGSDTYEPEDLRAMISAHFGTGWNQASGIADTVVSGVI*
Ga0066227_1001260Ga0066227_10012601F055278MRREGNARSALQSFQSCCSARGRYRRESSSYGIGCSFGEYHPLKYHRYCFGDPALPLVLTSAVRFSFSGLD*RLFRLPVTSSRRASPSFRVLPSNTYPAITMAESSHGLWLPSALEESEVYCSRASPTRYVPPSGFGYPLDGFLPRIPCRSCFIPAALLGFTLRRFPLPKGFRGVSTGKNPHTVNLHVTPAPKRRTGHANLGFWAHTFRKCLAYAGFLSRRPPAPPLGFAPSGPSCESLDRDFSQPPLTRFAGLAITHQTHRRPRVSVNSRLVSAEFAPEHKLAKTTLLGFPHRPHPGHSNTAPPGLLSSPCTGSLITADSPVLFGR*
Ga0066227_1002127Ga0066227_10021271F035541LRYVRSEGTGFHHRATTIRRSDVKRLALIFTLAILASLFLVPAAYAERHHGTTGLNIIPVTDTLEPGTLQWDVWARYNEDFPRGRRVHNRLFGALFDNFEFGMYWGISRRAGPLEFALKYKVLDEYEGRFPVSLAFGAEGITGNYQRTDRDPTLYGVLGIHDVHLGGWWDWYVGVSHNPTGYDDEDNSLFGGFKYWVNDDWQVNGDFWGYNDTGEYILAGGVNYDWANHVGFQGWVERDSVTEDNVFVLEVSFQADMTDLTAEVSDPE*
Ga0066227_1003179Ga0066227_10031792F028190MASITVKKYDGTTDIVYDALAASGGDGSPAVWRQDTGAASGLPVGLRSTFKVWSTWNGPKTARQVKANFVMPYAVQDSTTTLYSAKDRVVADIIFTMPQAIPAANLNEAYQICNLIAATLFKQMVAAGYSAT*
Ga0066227_1004668Ga0066227_10046682F043157VVGDRLMGILDERFRNCMCLNMYDRIDGMQMLGELVIIKRAKSLERRIR*
Ga0066227_1004809Ga0066227_10048091F014854PGRATAVSRLTPAVSRIIPGDWGKAEPGWLAGPLLSRIARSGGGGRIHQFLWRRSRVVSDATRNLAVRRDKKPRQAESSSPSWFRVWANRSYPEGIRLLLCISTGRVTLADSINRLDPPSESHRKVNKGSARAGKDTGTRQVP*
Ga0066227_1004853Ga0066227_10048531F006508VALANALSKAVADQSQVVKTRSKHCRRVLTWFASRWRNHQPKRA
Ga0066227_1006747Ga0066227_10067471F008255QIDIQELFMIVQMQEFVADSTAAIGNQVRKIRKDSVETVRGAAVDSAENLKSLKSPVRTLARSGIKLTAVSHSTVASLIELQSEVLTSAISDAALRLERASRADSVIKLVREQIEMIPATRTRIVEDAQRTASIFKHAGRDLRGVVTHLYEKVVEPTEEKAVAAAKTAKRKTKRAVRKTTTRARKTAA*
Ga0066227_1009494Ga0066227_10094941F048649MKKLIIALAALMVSIAAYGQGQFVFNNRIGTEVTARFITSSDPANGSSSSIGSPDWSVNIFGGPVGGTLVALDPASTGFRGAPGSTAAGYVVGVTPTVPGVAIGGNASVSLTVLGPGGVSQSFGPYTVNGLGGGTTTPPNLQL
Ga0066227_1009975Ga0066227_10099752F043157MGILDEHFRNCICLRIGDRIDSMQMLGEIVMIERAKSLERRIR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.