NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004333

3300004333: Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC3C



Overview

Basic Information
IMG/M Taxon OID3300004333 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110188 | Gp0091628 | Ga0066237
Sample NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC3C
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28105712
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria1
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)mangrove biomeintertidal zonesediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002557Metagenome / Metatranscriptome548Y
F014854Metagenome / Metatranscriptome259Y
F023129Metagenome / Metatranscriptome211Y
F030135Metagenome / Metatranscriptome186Y
F043157Metagenome / Metatranscriptome157Y
F067247Metagenome / Metatranscriptome126Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066237_100586All Organisms → cellular organisms → Bacteria → Proteobacteria1087Open in IMG/M
Ga0066237_101221All Organisms → cellular organisms → Bacteria899Open in IMG/M
Ga0066237_102018Not Available755Open in IMG/M
Ga0066237_103372Not Available632Open in IMG/M
Ga0066237_103398Not Available630Open in IMG/M
Ga0066237_103471Not Available626Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066237_100586Ga0066237_1005861F043157VDGDIPMSILDERFRNCICLSNYNRIESMQMLGELIIIERAKSLERRIR*
Ga0066237_101221Ga0066237_1012211F067247VKKLFSIGIVLALLVTFVVPVAIAAQDECCEWTPPNAVPLPDRTTKTLAGATMWTLLGVTDIMGKAVCATTGQMAANLGGWSDELGVIGVDVTVAALKGIGGLIDGVIGQFLPDFADLGAGVVDLINGIADALAGATEG*
Ga0066237_102018Ga0066237_1020181F030135KVREELATLSSFTDIWHSTFAGRQFPDAILPGREAIDLVAGPLN*
Ga0066237_103372Ga0066237_1033721F014854SRLTPAVSRIIPGDWGKAEPGWLAGPLLSRIARSGGGGRIHQFLWRRSRVVSDATRNLAVRRDKKPRQAESSSPSWFRVWANRSYPEGIRLLLCISTGRVTLADSINRLDPPSESHRKVNKGSARAGKDTGTRQVP*
Ga0066237_103398Ga0066237_1033981F002557VLMHIATEYPLGNCDSPRLETGPGYLTRFEAASYRSLSLSPFFAFTDSARTPPEELV
Ga0066237_103471Ga0066237_1034711F023129MVKTLPLACECKGNLRVKRRDPWPRANALSKAAADPELSGQDAQQPSQTCLDLVRKPVAQPPAQAS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.