Basic Information | |
---|---|
IMG/M Taxon OID | 3300003966 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113966 | Gp0109824 | Ga0063591 |
Sample Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie HABS-00-39862 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Michigan |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 331374827 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 2 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Cephalotes Varians → Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → glacial lake → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Lake Fryxell, Antarctica | |||||||
Coordinates | Lat. (o) | 24.6333167 | Long. (o) | 163.119356 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058681 | Metagenome | 134 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0063591_101905 | Ga0063591_1019052 | F058681 | MVKGLHTMYLMPNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA* |
Ga0063591_102082 | Ga0063591_1020821 | F058681 | VNMLRRSRVRPNVRAKLPAEARSVSLVRDDASMAADQAYA |
⦗Top⦘ |