Basic Information | |
---|---|
Family ID | F058681 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 38 residues |
Representative Sequence | VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS |
Number of Associated Samples | 41 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.75 % |
% of genes from short scaffolds (< 2000 bps) | 0.75 % |
Associated GOLD sequencing projects | 36 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.254 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (53.788 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.418 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (53.731 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF00583 | Acetyltransf_1 | 3.73 |
PF13302 | Acetyltransf_3 | 2.99 |
PF12680 | SnoaL_2 | 2.24 |
PF12681 | Glyoxalase_2 | 2.24 |
PF00472 | RF-1 | 1.49 |
PF14319 | Zn_Tnp_IS91 | 1.49 |
PF13714 | PEP_mutase | 1.49 |
PF09932 | DUF2164 | 1.49 |
PF13673 | Acetyltransf_10 | 1.49 |
PF04365 | BrnT_toxin | 0.75 |
PF06877 | RraB | 0.75 |
PF06941 | NT5C | 0.75 |
PF04471 | Mrr_cat | 0.75 |
PF00795 | CN_hydrolase | 0.75 |
PF01555 | N6_N4_Mtase | 0.75 |
PF05016 | ParE_toxin | 0.75 |
PF04273 | BLH_phosphatase | 0.75 |
PF06649 | DUF1161 | 0.75 |
PF00903 | Glyoxalase | 0.75 |
PF01451 | LMWPc | 0.75 |
PF03544 | TonB_C | 0.75 |
PF07978 | NIPSNAP | 0.75 |
PF14080 | DUF4261 | 0.75 |
PF14078 | DUF4259 | 0.75 |
PF13391 | HNH_2 | 0.75 |
PF04945 | YHS | 0.75 |
PF14337 | Abi_alpha | 0.75 |
PF13560 | HTH_31 | 0.75 |
PF04828 | GFA | 0.75 |
PF11969 | DcpS_C | 0.75 |
PF13417 | GST_N_3 | 0.75 |
PF08241 | Methyltransf_11 | 0.75 |
PF13531 | SBP_bac_11 | 0.75 |
PF07883 | Cupin_2 | 0.75 |
PF12867 | DinB_2 | 0.75 |
PF11695 | DUF3291 | 0.75 |
PF08378 | NERD | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.49 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.49 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.75 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.75 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.75 |
COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.75 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.75 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.25 % |
All Organisms | root | All Organisms | 0.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100451110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1228 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 53.79% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 26.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.79% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003966 | Enrichment cultures from Harmful Algal Blooms in Lake Erie HABS-00-39862 | Host-Associated | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
3300005961 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA | Engineered | Open in IMG/M |
3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300020522 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300027673 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes) | Engineered | Open in IMG/M |
3300027786 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1002323274 | 3300002835 | Freshwater | MRPNVGAKLPAEADDVSLVCEGAEGAARQACDGCRSGSA* |
B570J40625_1004511104 | 3300002835 | Freshwater | CEWIARPNVRAKLPAEAGFVSPVRDDGTTGADRAYKACRRGSA* |
B570J40625_1009827343 | 3300002835 | Freshwater | MCDLGPNVRAKLPEEACSVSLVCEGAEGAAHQAYAACRSGS |
B570J40625_1011697222 | 3300002835 | Freshwater | LAQPNVRAKLPAEAGAVSLVRDDAPCAVDQAYSACRSGSA* |
Ga0063591_1019052 | 3300003966 | MVKGLHTMYLMPNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA* | |
Ga0063591_1020821 | 3300003966 | VNMLRRSRVRPNVRAKLPAEARSVSLVRDDASMAADQAYA | |
Ga0068877_101188641 | 3300005525 | Freshwater Lake | MPNVRGNLPAEARSVSLVRDNASMAADQAYAACRSGSG |
Ga0068877_101793572 | 3300005525 | Freshwater Lake | MAGDIGSEANVRVKPPAEAGSVSLVCEGAEGAAHQAYAACRSGSA* |
Ga0068877_102909411 | 3300005525 | Freshwater Lake | VLVVRPNVRAKLPVEAGAVSLVRDDAPSAADQAYSACR |
Ga0068877_103259451 | 3300005525 | Freshwater Lake | MTTPNVRTKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0068877_104095562 | 3300005525 | Freshwater Lake | PNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA* |
Ga0068877_104122032 | 3300005525 | Freshwater Lake | RVKPPAEAGSVSLVRDDAPCAADQAYAACRSGSA* |
Ga0068877_104457372 | 3300005525 | Freshwater Lake | MMAERYIAFVRPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA |
Ga0068877_106279392 | 3300005525 | Freshwater Lake | MPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0068876_103788364 | 3300005527 | Freshwater Lake | PNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA* |
Ga0068872_103080831 | 3300005528 | Freshwater Lake | PNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA* |
Ga0073902_101202693 | 3300005656 | Activated Sludge | VPPNVRAKLLAEACLVSLVRENVQGTADQAYNACRSGSA |
Ga0075157_100073641 | 3300005961 | Wastewater Effluent | RAKLPAEAGAVSLVRDDAPRAADQAYSACRSGSA* |
Ga0075157_100298871 | 3300005961 | Wastewater Effluent | RAKLPAEAGVVSLVRDDAPCAADQAYSACRSGSA* |
Ga0075157_100306047 | 3300005961 | Wastewater Effluent | MPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0075157_100618573 | 3300005961 | Wastewater Effluent | MPNVRAKPTAEAGGVSLVRDDAPCAADQAYAACRS |
Ga0075157_100637621 | 3300005961 | Wastewater Effluent | VWIVQPNVRAKLPAEAGAVSLVRDDAPRAADQAYSACR |
Ga0075157_100991201 | 3300005961 | Wastewater Effluent | RAKLPAEAGAVSLVREDAPCAADQAYSACRSGSA* |
Ga0075157_101193951 | 3300005961 | Wastewater Effluent | VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0075157_101353442 | 3300005961 | Wastewater Effluent | VILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS |
Ga0075157_101389351 | 3300005961 | Wastewater Effluent | PNVRAKLPAEAGAVSLVRDDASRAADQAYSACRSGSA* |
Ga0075157_101449972 | 3300005961 | Wastewater Effluent | VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRGGSA* |
Ga0075157_101517372 | 3300005961 | Wastewater Effluent | MLVARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC |
Ga0075157_101567751 | 3300005961 | Wastewater Effluent | RAKLPAEASTVSPGCDDAPSAAARAYSACRSGSA* |
Ga0075157_101924841 | 3300005961 | Wastewater Effluent | MRPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSG |
Ga0075157_102153111 | 3300005961 | Wastewater Effluent | VVVVTPNVRAKLPAEAGAVSLVRDDAPTAADQAYSACRSGSA* |
Ga0075157_102191092 | 3300005961 | Wastewater Effluent | VQPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACR |
Ga0075157_102273262 | 3300005961 | Wastewater Effluent | MRLVARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0075157_102341781 | 3300005961 | Wastewater Effluent | PNVRAKLPAEACVVSLVRENVQGTANQAYNACRSGSA* |
Ga0075157_102477841 | 3300005961 | Wastewater Effluent | PNVRAKPTAEAGGVSLVRDDAPCAADQAYDACRSGSA* |
Ga0075157_102496751 | 3300005961 | Wastewater Effluent | FLMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA* |
Ga0075157_102556923 | 3300005961 | Wastewater Effluent | PNVRAKPTAEAGAVSPDRDDSTNGAVRAYSACRSGSA* |
Ga0075157_102661172 | 3300005961 | Wastewater Effluent | TPNVRAKLPAEAGAVSLVRDDAPGAADQAYSACRSGSA* |
Ga0075157_102735162 | 3300005961 | Wastewater Effluent | MWNARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0075157_102848791 | 3300005961 | Wastewater Effluent | MERRREDMTIVRPNVRAKLPAEAGAVSPVRDDAPCAADRAYSACRSGSA* |
Ga0075157_103069261 | 3300005961 | Wastewater Effluent | PNVRAKLPAEAGGVRLVRDDAPSAADQPYDACRSGSA* |
Ga0075157_103329301 | 3300005961 | Wastewater Effluent | ARPNVRAKLPAEAGAVSLVRDDATCAANQAYSACRSGSA* |
Ga0075157_103449581 | 3300005961 | Wastewater Effluent | PNVRAKLPAEAGAVSPGRDDAPFAAARAYSACRSGSA* |
Ga0075157_103523001 | 3300005961 | Wastewater Effluent | LIVQPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0075157_103544232 | 3300005961 | Wastewater Effluent | RAKPTAEAGAVSPVRDDSTNGADRAYSACRSGSA* |
Ga0075154_101422494 | 3300005989 | Wastewater Effluent | VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS |
Ga0075154_101580771 | 3300005989 | Wastewater Effluent | PNVRAKLPAEAGAVSLVRDDAPSAANQAYSACRSGSA* |
Ga0075154_103945361 | 3300005989 | Wastewater Effluent | TPNVRAKLPAEAGTVSLVRDDASRAADQAYSACRSGSA* |
Ga0075154_105020881 | 3300005989 | Wastewater Effluent | RAKLPAEAGGVRLVRDDAPCAADQPYAACRSGSA* |
Ga0114341_103265911 | 3300008108 | Freshwater, Plankton | VLPNVRAKLAAEAGAVSLVRDDAPSAADQAYTACRS |
Ga0114356_13835112 | 3300008121 | Freshwater, Plankton | VAFVRPNVRVKPPAEAGSVSLVRDDAPCAADQAYAACRS |
Ga0164293_107664711 | 3300013004 | Freshwater | LGSGICVGVRPNVGAKLPAEARSVSLVRDDASRAADQAYAA |
Ga0208327_10210941 | 3300020522 | Freshwater | MNVRPNVGAKLPAEARSVSLVRDDASRAADQAYAAC |
Ga0209278_10335885 | 3300027673 | Wastewater Effluent | VTPNVRGNLPAEARSVSLVRDDASMAADQAYAACRSGS |
Ga0209278_10474671 | 3300027673 | Wastewater Effluent | VTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACR |
Ga0209812_101483642 | 3300027786 | Wastewater Effluent | EALDPHTKARFLMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0209985_100622461 | 3300027806 | Freshwater Lake | MLNVRPNVRGNLPAEARSVSLVRDNASMAADQAYAA |
Ga0209985_101168121 | 3300027806 | Freshwater Lake | MTPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSG |
Ga0209985_101446901 | 3300027806 | Freshwater Lake | MRPNVRGNLPAEARSVSLVRDDASRAADQAYAACR |
Ga0209985_102619912 | 3300027806 | Freshwater Lake | MPNVRGNLPAEARSVSLVRDNASMAADQAYAACRSGS |
Ga0209985_102722771 | 3300027806 | Freshwater Lake | VLVVKPNVRVKPPAEAGSVSLVRDDAPCAADQAYAA |
Ga0209990_101335901 | 3300027816 | Freshwater Lake | MVDVNARPNVRAKLPAEAGAVSPVRDNSTAGADRAYSAC |
Ga0307408_1013268922 | 3300031548 | Rhizosphere | MMANVRVNRPAEAGGVRLVCEGAEGAAHQAYAACRSGSG |
Ga0315902_108462291 | 3300032093 | Freshwater | VLPNVRAKLPAEACSVSLVCEGAEGAAQQAYAACRS |
Ga0334977_0097635_1432_1572 | 3300033978 | Freshwater | MGVGGFCVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0334977_0375742_558_665 | 3300033978 | Freshwater | MTPNVGAKLPAEARSVSLVRDDASRAADQAYAACRS |
Ga0334981_0108024_1_120 | 3300033980 | Freshwater | MIVLPNVRVKLRATAGSVSLVREDVRSTADQAYAACRSVS |
Ga0334981_0238749_3_113 | 3300033980 | Freshwater | MNLMPNVGAKLPAEARSVSLVRDDASRAADQAYAACR |
Ga0334981_0298796_2_121 | 3300033980 | Freshwater | MRMVVFVMPNVGAKLPAEAGAVSLVRDDAPSAADQAYSAC |
Ga0334981_0395282_3_110 | 3300033980 | Freshwater | MLACGLLRPNVGAKRPAEAGAVSLVRDDAPSAADQA |
Ga0334981_0401623_480_584 | 3300033980 | Freshwater | MTPNVRGNLPAEARSVSLVRDDASRAADQAYAACR |
Ga0334982_0350823_567_680 | 3300033981 | Freshwater | MTPNVGAKLPAEARSVSLVRDDASRAADQAYAACRSGS |
Ga0334982_0375362_2_115 | 3300033981 | Freshwater | MMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0334982_0495841_436_540 | 3300033981 | Freshwater | MLFGGPNVGAKLPAEARSVSLVRDDASRAADQAYA |
Ga0334992_0167088_1004_1117 | 3300033992 | Freshwater | MLKRALVRPNVGAKLPAEARSVSLVRDDASRAADQAYA |
Ga0334996_0075035_3_113 | 3300033994 | Freshwater | MSGIRTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA |
Ga0334996_0182608_583_708 | 3300033994 | Freshwater | MALTPNVRAKLPAEAGAVSLVRDDAPRAANQAYSACRSGSA |
Ga0334996_0188444_990_1112 | 3300033994 | Freshwater | MSVKPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0334996_0206752_2_109 | 3300033994 | Freshwater | MFPGGPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA |
Ga0334996_0219347_878_1000 | 3300033994 | Freshwater | MFVTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA |
Ga0334996_0234397_828_953 | 3300033994 | Freshwater | METSFMRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSG |
Ga0334996_0314305_2_115 | 3300033994 | Freshwater | MVVRNFVTPNVGAKLPAEAGAVSLVRDDAPSAADQAYS |
Ga0334996_0470231_2_112 | 3300033994 | Freshwater | NVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA |
Ga0334996_0528511_3_128 | 3300033994 | Freshwater | MSGKRSNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0334979_0264351_2_112 | 3300033996 | Freshwater | MPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0334979_0266863_879_983 | 3300033996 | Freshwater | MSNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS |
Ga0334979_0407600_640_750 | 3300033996 | Freshwater | MKPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSG |
Ga0334998_0052275_2729_2842 | 3300034019 | Freshwater | MRSNVGAKLPAEARSVSLVRDDASRAADQAYAACRSGS |
Ga0334998_0549846_526_636 | 3300034019 | Freshwater | MRPNVGAKLPAEARSVSLVRDDASRAPDQAYAACRSG |
Ga0335002_0123700_1580_1717 | 3300034020 | Freshwater | MSLKQYLILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS |
Ga0335002_0220573_2_115 | 3300034020 | Freshwater | MRPNVGAKLPAEARSVSLVRDDASRAPDQAYAACRSGS |
Ga0335002_0369299_3_125 | 3300034020 | Freshwater | MVVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0335002_0425128_622_729 | 3300034020 | Freshwater | MMPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRS |
Ga0335002_0482853_3_137 | 3300034020 | Freshwater | MGWIVRQQCVCVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSAC |
Ga0335002_0537762_3_146 | 3300034020 | Freshwater | MVRVNAGFLATPNVRAKLPAEACSVSLVCEGAEGAAHRAYAACRSGSA |
Ga0335002_0566432_2_127 | 3300034020 | Freshwater | MASRPRAFVMPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC |
Ga0335002_0676425_1_120 | 3300034020 | Freshwater | MHCEWIARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC |
Ga0334987_0270347_1010_1144 | 3300034061 | Freshwater | MSSCDARSVRPNVRAKLPAEAGAVSLVRDDAPSAAAQAYSACRSG |
Ga0334987_0385505_784_891 | 3300034061 | Freshwater | MTWEVMTPNVRAKLPAEAGAVSLVRDDAPCAADQAY |
Ga0334987_0470562_2_121 | 3300034061 | Freshwater | MGLGPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0334987_0517439_3_143 | 3300034061 | Freshwater | GSAAVWVVRPNVRAKLPAEADGVSLVCEGAEGAAHQAYDDCRSGSA |
Ga0334987_0588082_2_112 | 3300034061 | Freshwater | MLTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACR |
Ga0334987_0641235_504_617 | 3300034061 | Freshwater | MLECHRRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA |
Ga0334995_0718658_3_113 | 3300034062 | Freshwater | MFPGGPNVRAKLPAEAGAVSLVRDDAPSAADQAYSAC |
Ga0335019_0165569_1343_1447 | 3300034066 | Freshwater | MCFARPNVRAKLPAEAGAVSLVRDDAPCAADQAYS |
Ga0335019_0180100_1271_1375 | 3300034066 | Freshwater | MTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACR |
Ga0335019_0293515_3_113 | 3300034066 | Freshwater | MGLRMPNVRAKLPVEACSVSLVCEGAEGAAHQAYAAC |
Ga0335019_0587417_529_654 | 3300034066 | Freshwater | MTCEVMTPNVRVKPPVEAGSVSLVCEGAEGAAHLAYAACRSG |
Ga0335019_0591923_2_106 | 3300034066 | Freshwater | MTVTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA |
Ga0335019_0610408_528_635 | 3300034066 | Freshwater | MKPNVRAKLPTEAGAVSLVRDDAPSAADQAYSACRS |
Ga0335028_0456554_602_715 | 3300034071 | Freshwater | MTPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS |
Ga0335010_0525968_493_615 | 3300034092 | Freshwater | MWWWNLRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS |
Ga0335025_0168175_1_105 | 3300034096 | Freshwater | MSNVGAKLPAEARSVSLVRDDASRAADQAYAACRS |
Ga0335029_0469641_12_137 | 3300034102 | Freshwater | MALTPNVRAKLPAKAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0335030_0456855_707_814 | 3300034103 | Freshwater | MFLPPNVGAKLPAEARSVSLVRDDASRAADQAYAAC |
Ga0335031_0268273_1006_1122 | 3300034104 | Freshwater | MQTAALVRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA |
Ga0335063_0468132_3_110 | 3300034111 | Freshwater | MRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRS |
Ga0335066_0193711_2_130 | 3300034112 | Freshwater | MCVHVMPNVRGNLPAEARSVSLVRDDASRAADQAYAACRSGSG |
Ga0335066_0491796_543_650 | 3300034112 | Freshwater | MMPNVRAKLPAEARSVSLVRDDASRPADQAYAACRS |
Ga0335054_0131811_1420_1530 | 3300034119 | Freshwater | MVLLVLPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA |
Ga0335054_0343128_760_864 | 3300034119 | Freshwater | MLPNVRAKLPTEAGAVSLVRDDAPSAADQAYSACR |
Ga0335054_0424972_627_755 | 3300034119 | Freshwater | VLLVLPNVRAKLPAEADGVSLVCEGAEGAAHQAYDDCRSGSA |
Ga0335054_0584452_479_613 | 3300034119 | Freshwater | MASRPRAFVMPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSG |
Ga0335054_0785578_387_503 | 3300034119 | Freshwater | MLFGGPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS |
Ga0335056_0466424_2_118 | 3300034120 | Freshwater | MDIASLVRPNVGAKLPAEARSVSLVRDDASRAADQAYAA |
Ga0335049_0264254_745_870 | 3300034272 | Freshwater | MNVMPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA |
Ga0335049_0278262_1006_1140 | 3300034272 | Freshwater | MSLKQYLILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSG |
Ga0335049_0337092_866_1006 | 3300034272 | Freshwater | MEPALSGFMRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA |
Ga0335049_0525341_641_748 | 3300034272 | Freshwater | MNVMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSAC |
Ga0335049_0601943_566_679 | 3300034272 | Freshwater | MELALSGFMRPNVRAKLPAEACSVSLVCEGAEGAAHQA |
Ga0335049_0624163_2_106 | 3300034272 | Freshwater | MVLPNVRAKLPAKAGAVSLVRDDAPSAADQAYSAC |
Ga0335007_0306588_885_1037 | 3300034283 | Freshwater | SSVAMNIGGLFVMPNVRAKLPAEACGVSLVCDGAEGAAHQAYAACRSGSA |
Ga0335007_0639114_498_605 | 3300034283 | Freshwater | MLPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRS |
Ga0335007_0699479_3_113 | 3300034283 | Freshwater | NVRATLPAEACSVSLMCEGAEGAAHQAYAACRSGSA |
⦗Top⦘ |