| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003086 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0097384 | Gp0097427 | Ga0052187 |
| Sample Name | Marine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2311950 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal plume → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lau and Guaymas Basin | |||||||
| Coordinates | Lat. (o) | -20.053234 | Long. (o) | -176.133763 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014191 | Metagenome / Metatranscriptome | 265 | Y |
| F036429 | Metagenome / Metatranscriptome | 170 | N |
| F105866 | Metagenome / Metatranscriptome | 100 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0052187_10045 | Not Available | 86515 | Open in IMG/M |
| Ga0052187_10046 | Not Available | 50322 | Open in IMG/M |
| Ga0052187_10081 | Not Available | 73697 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0052187_10005 | Ga0052187_100053 | F036429 | MATVKSVEITNLDATPRTTLEAASAGGKLRVWMDTIAVGTGDLDDDDIIILGQVPSNAKIVSLMIYNDDLNSGSGTHNVGLYNGPQAYTISGTTTAAAAVIDEDCYVTDSTAFRAAVTEPVELLAETRNINAIANFVWEDGGLSEDPKVPLRLAVTMSAVGTAIAGDITLVVKYTID* |
| Ga0052187_10045 | Ga0052187_1004590 | F014191 | MDLTFITAELLNDISWFDGIAYTVLGLVVYAVAKYINTKIN* |
| Ga0052187_10046 | Ga0052187_1004610 | F105866 | MATEDTGFTQIPYVRKDDTFKEWRERTNLMIQQQNNFVRMQEFDMLGVSDVWVKTSMQLNYSGETEN* |
| Ga0052187_10081 | Ga0052187_10081127 | F014191 | MDLRFITAELLNDISWFDGIMYIILGIGIYAIIKYINTKIN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |