


| Basic Information | |
|---|---|
| Family ID | F014191 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 265 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDLSFITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Number of Associated Samples | 195 |
| Number of Associated Scaffolds | 265 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.68 % |
| % of genes near scaffold ends (potentially truncated) | 34.72 % |
| % of genes from short scaffolds (< 2000 bps) | 75.85 % |
| Associated GOLD sequencing projects | 178 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.792 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (20.377 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.566 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.585 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 265 Family Scaffolds |
|---|---|---|
| PF11053 | DNA_Packaging | 12.83 |
| PF03237 | Terminase_6N | 9.43 |
| PF01230 | HIT | 7.55 |
| PF13537 | GATase_7 | 5.28 |
| PF16724 | T4-gp15_tss | 3.77 |
| PF05226 | CHASE2 | 3.40 |
| PF02739 | 5_3_exonuc_N | 2.64 |
| PF04358 | DsrC | 1.51 |
| PF13186 | SPASM | 1.51 |
| PF11649 | T4_neck-protein | 1.51 |
| PF00487 | FA_desaturase | 1.51 |
| PF01521 | Fe-S_biosyn | 1.13 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.75 |
| PF01370 | Epimerase | 0.75 |
| PF13534 | Fer4_17 | 0.75 |
| PF12705 | PDDEXK_1 | 0.38 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.38 |
| PF00156 | Pribosyltran | 0.38 |
| PF05050 | Methyltransf_21 | 0.38 |
| PF13522 | GATase_6 | 0.38 |
| PF03477 | ATP-cone | 0.38 |
| PF00090 | TSP_1 | 0.38 |
| PF02675 | AdoMet_dc | 0.38 |
| PF04325 | DUF465 | 0.38 |
| PF03783 | CsgG | 0.38 |
| PF07087 | DUF1353 | 0.38 |
| PF01192 | RNA_pol_Rpb6 | 0.38 |
| PF00384 | Molybdopterin | 0.38 |
| PF04321 | RmlD_sub_bind | 0.38 |
| PF01592 | NifU_N | 0.38 |
| PF02773 | S-AdoMet_synt_C | 0.38 |
| PF13343 | SBP_bac_6 | 0.38 |
| PF01206 | TusA | 0.38 |
| PF04984 | Phage_sheath_1 | 0.38 |
| PF13847 | Methyltransf_31 | 0.38 |
| PF00293 | NUDIX | 0.38 |
| PF01242 | PTPS | 0.38 |
| PF00034 | Cytochrom_C | 0.38 |
| PF13489 | Methyltransf_23 | 0.38 |
| PF00793 | DAHP_synth_1 | 0.38 |
| PF01041 | DegT_DnrJ_EryC1 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 265 Family Scaffolds |
|---|---|---|---|
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 3.40 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.64 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.51 |
| COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 1.51 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.51 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.13 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.13 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 0.75 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.38 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.38 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.38 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.38 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.38 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.38 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.38 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.38 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.38 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.38 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.38 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.38 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.21 % |
| Unclassified | root | N/A | 46.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10021758 | All Organisms → Viruses → Predicted Viral | 3723 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10187681 | Not Available | 709 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10194089 | Not Available | 689 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10061192 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10128046 | Not Available | 874 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1005997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1040 | Open in IMG/M |
| 3300001392|Lau_10068399 | All Organisms → Viruses → Predicted Viral | 2214 | Open in IMG/M |
| 3300001450|JGI24006J15134_10039637 | Not Available | 2001 | Open in IMG/M |
| 3300001515|KiloMoana_1060064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300001515|KiloMoana_1097620 | Not Available | 765 | Open in IMG/M |
| 3300001516|TahiMoana_1142394 | Not Available | 598 | Open in IMG/M |
| 3300001680|KiloMoana_10048446 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300001973|GOS2217_10129143 | All Organisms → Viruses → Predicted Viral | 1653 | Open in IMG/M |
| 3300001974|GOS2246_10011021 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300002483|JGI25132J35274_1053930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300003086|Ga0052187_10045 | Not Available | 86515 | Open in IMG/M |
| 3300003086|Ga0052187_10081 | Not Available | 73697 | Open in IMG/M |
| 3300003185|JGI26064J46334_1068382 | Not Available | 672 | Open in IMG/M |
| 3300003474|NAP4_1077769 | Not Available | 676 | Open in IMG/M |
| 3300003585|JGI26249J51723_1040915 | Not Available | 759 | Open in IMG/M |
| 3300004097|Ga0055584_100507557 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| 3300005057|Ga0068511_1046309 | Not Available | 705 | Open in IMG/M |
| 3300005239|Ga0073579_1103786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300005239|Ga0073579_1182114 | All Organisms → cellular organisms → Bacteria | 6443 | Open in IMG/M |
| 3300005432|Ga0066845_10141690 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005735|Ga0076923_120749 | Not Available | 9164 | Open in IMG/M |
| 3300005747|Ga0076924_1046895 | Not Available | 5047 | Open in IMG/M |
| 3300005971|Ga0066370_10018224 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300006024|Ga0066371_10153641 | Not Available | 707 | Open in IMG/M |
| 3300006024|Ga0066371_10239713 | Not Available | 566 | Open in IMG/M |
| 3300006077|Ga0081594_1001364 | Not Available | 18977 | Open in IMG/M |
| 3300006077|Ga0081594_1003094 | Not Available | 12576 | Open in IMG/M |
| 3300006077|Ga0081594_1003115 | Not Available | 12536 | Open in IMG/M |
| 3300006077|Ga0081594_1003178 | Not Available | 12413 | Open in IMG/M |
| 3300006077|Ga0081594_1003328 | Not Available | 12119 | Open in IMG/M |
| 3300006077|Ga0081594_1006022 | Not Available | 8835 | Open in IMG/M |
| 3300006077|Ga0081594_1040409 | All Organisms → Viruses → Predicted Viral | 2701 | Open in IMG/M |
| 3300006077|Ga0081594_1154137 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 958 | Open in IMG/M |
| 3300006077|Ga0081594_1160756 | Not Available | 924 | Open in IMG/M |
| 3300006079|Ga0081601_1128724 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 875 | Open in IMG/M |
| 3300006166|Ga0066836_10668375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300006332|Ga0068500_1358644 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300006332|Ga0068500_1410631 | Not Available | 506 | Open in IMG/M |
| 3300006334|Ga0099675_1043731 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
| 3300006334|Ga0099675_1054081 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300006403|Ga0075514_1777421 | Not Available | 1266 | Open in IMG/M |
| 3300006565|Ga0100228_1169963 | Not Available | 661 | Open in IMG/M |
| 3300006737|Ga0098037_1007181 | All Organisms → cellular organisms → Bacteria | 4468 | Open in IMG/M |
| 3300006749|Ga0098042_1014127 | All Organisms → Viruses → Predicted Viral | 2441 | Open in IMG/M |
| 3300006749|Ga0098042_1052863 | All Organisms → Viruses | 1098 | Open in IMG/M |
| 3300006793|Ga0098055_1021006 | Not Available | 2792 | Open in IMG/M |
| 3300006802|Ga0070749_10069699 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300006802|Ga0070749_10334723 | Not Available | 843 | Open in IMG/M |
| 3300006902|Ga0066372_10265453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 960 | Open in IMG/M |
| 3300006924|Ga0098051_1052948 | Not Available | 1120 | Open in IMG/M |
| 3300007113|Ga0101666_1012801 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300007510|Ga0105013_1029831 | Not Available | 6070 | Open in IMG/M |
| 3300007623|Ga0102948_1135749 | Not Available | 752 | Open in IMG/M |
| 3300007755|Ga0105014_1059129 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300007778|Ga0102954_1144909 | Not Available | 680 | Open in IMG/M |
| 3300008627|Ga0115656_1031553 | All Organisms → Viruses → Predicted Viral | 3340 | Open in IMG/M |
| 3300008954|Ga0115650_1040274 | Not Available | 4339 | Open in IMG/M |
| 3300009001|Ga0102963_1043574 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300009071|Ga0115566_10241051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1086 | Open in IMG/M |
| 3300009103|Ga0117901_1327481 | Not Available | 652 | Open in IMG/M |
| 3300009173|Ga0114996_10589366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300009173|Ga0114996_11269271 | Not Available | 513 | Open in IMG/M |
| 3300009423|Ga0115548_1051203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300009423|Ga0115548_1075917 | Not Available | 1133 | Open in IMG/M |
| 3300009425|Ga0114997_10160063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1323 | Open in IMG/M |
| 3300009436|Ga0115008_10047047 | All Organisms → Viruses → Predicted Viral | 3357 | Open in IMG/M |
| 3300009481|Ga0114932_10029321 | All Organisms → Viruses → Predicted Viral | 3682 | Open in IMG/M |
| 3300009481|Ga0114932_10278614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300009508|Ga0115567_10133264 | All Organisms → Viruses | 1672 | Open in IMG/M |
| 3300009544|Ga0115006_11257301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300009550|Ga0115013_10414486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 861 | Open in IMG/M |
| 3300009550|Ga0115013_10531604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 773 | Open in IMG/M |
| 3300009593|Ga0115011_10049925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2857 | Open in IMG/M |
| 3300009705|Ga0115000_10659352 | Not Available | 648 | Open in IMG/M |
| 3300009790|Ga0115012_11473889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300010148|Ga0098043_1197721 | Not Available | 557 | Open in IMG/M |
| 3300010883|Ga0133547_11908260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300011253|Ga0151671_1114956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300011258|Ga0151677_1087874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300012920|Ga0160423_10001681 | Not Available | 18519 | Open in IMG/M |
| 3300012920|Ga0160423_10037755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 3554 | Open in IMG/M |
| 3300012920|Ga0160423_10404285 | Not Available | 933 | Open in IMG/M |
| 3300012928|Ga0163110_10020219 | All Organisms → Viruses → Predicted Viral | 3900 | Open in IMG/M |
| 3300012928|Ga0163110_10201068 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| 3300012952|Ga0163180_10045661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2617 | Open in IMG/M |
| 3300012952|Ga0163180_10166745 | All Organisms → Viruses → Predicted Viral | 1477 | Open in IMG/M |
| 3300012952|Ga0163180_10585018 | Not Available | 847 | Open in IMG/M |
| 3300012952|Ga0163180_11197022 | Not Available | 620 | Open in IMG/M |
| 3300012953|Ga0163179_10060063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2644 | Open in IMG/M |
| 3300012953|Ga0163179_10067408 | All Organisms → Viruses → Predicted Viral | 2506 | Open in IMG/M |
| 3300012953|Ga0163179_10413016 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300012954|Ga0163111_10077344 | All Organisms → Viruses → Predicted Viral | 2671 | Open in IMG/M |
| 3300016735|Ga0182074_1032698 | Not Available | 559 | Open in IMG/M |
| 3300016771|Ga0182082_1595712 | Not Available | 605 | Open in IMG/M |
| 3300016787|Ga0182080_1406088 | Not Available | 539 | Open in IMG/M |
| 3300016791|Ga0182095_1073206 | Not Available | 637 | Open in IMG/M |
| 3300016797|Ga0182090_1479740 | Not Available | 1443 | Open in IMG/M |
| 3300016797|Ga0182090_1779513 | Not Available | 707 | Open in IMG/M |
| 3300017708|Ga0181369_1108369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 573 | Open in IMG/M |
| 3300017721|Ga0181373_1028197 | Not Available | 1040 | Open in IMG/M |
| 3300017730|Ga0181417_1162596 | Not Available | 538 | Open in IMG/M |
| 3300017730|Ga0181417_1164043 | Not Available | 535 | Open in IMG/M |
| 3300017731|Ga0181416_1143168 | Not Available | 576 | Open in IMG/M |
| 3300017732|Ga0181415_1027161 | Not Available | 1324 | Open in IMG/M |
| 3300017735|Ga0181431_1043165 | Not Available | 1024 | Open in IMG/M |
| 3300017739|Ga0181433_1070100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300017744|Ga0181397_1122849 | Not Available | 673 | Open in IMG/M |
| 3300017745|Ga0181427_1012633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2118 | Open in IMG/M |
| 3300017749|Ga0181392_1209252 | Not Available | 558 | Open in IMG/M |
| 3300017758|Ga0181409_1041181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1439 | Open in IMG/M |
| 3300017760|Ga0181408_1053102 | Not Available | 1081 | Open in IMG/M |
| 3300017770|Ga0187217_1160889 | All Organisms → Viruses | 750 | Open in IMG/M |
| 3300017775|Ga0181432_1230228 | Not Available | 583 | Open in IMG/M |
| 3300017783|Ga0181379_1202183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M | 695 | Open in IMG/M |
| 3300017818|Ga0181565_10008347 | Not Available | 7861 | Open in IMG/M |
| 3300017818|Ga0181565_10028485 | All Organisms → Viruses → Predicted Viral | 4113 | Open in IMG/M |
| 3300017818|Ga0181565_10630543 | Not Available | 685 | Open in IMG/M |
| 3300017824|Ga0181552_10033626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3109 | Open in IMG/M |
| 3300017824|Ga0181552_10105091 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300017949|Ga0181584_10010359 | Not Available | 6914 | Open in IMG/M |
| 3300017949|Ga0181584_10166959 | Not Available | 1466 | Open in IMG/M |
| 3300017949|Ga0181584_10377020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300017949|Ga0181584_10380093 | Not Available | 888 | Open in IMG/M |
| 3300017949|Ga0181584_10794514 | Not Available | 560 | Open in IMG/M |
| 3300017950|Ga0181607_10008903 | Not Available | 8250 | Open in IMG/M |
| 3300017950|Ga0181607_10028453 | All Organisms → Viruses → Predicted Viral | 4075 | Open in IMG/M |
| 3300017950|Ga0181607_10049183 | Not Available | 2875 | Open in IMG/M |
| 3300017950|Ga0181607_10481118 | Not Available | 666 | Open in IMG/M |
| 3300017951|Ga0181577_10124343 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300017956|Ga0181580_10150549 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300017956|Ga0181580_10196783 | Not Available | 1417 | Open in IMG/M |
| 3300017956|Ga0181580_10365327 | Not Available | 968 | Open in IMG/M |
| 3300017958|Ga0181582_10026548 | All Organisms → Viruses → Predicted Viral | 4543 | Open in IMG/M |
| 3300017958|Ga0181582_10101145 | All Organisms → Viruses → Predicted Viral | 2078 | Open in IMG/M |
| 3300017958|Ga0181582_10133563 | Not Available | 1751 | Open in IMG/M |
| 3300017962|Ga0181581_10069121 | All Organisms → Viruses → Predicted Viral | 2473 | Open in IMG/M |
| 3300017962|Ga0181581_10218393 | Not Available | 1253 | Open in IMG/M |
| 3300017964|Ga0181589_10919949 | Not Available | 536 | Open in IMG/M |
| 3300017969|Ga0181585_10291759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300017985|Ga0181576_10320009 | Not Available | 984 | Open in IMG/M |
| 3300018036|Ga0181600_10427133 | Not Available | 639 | Open in IMG/M |
| 3300018049|Ga0181572_10019135 | All Organisms → cellular organisms → Bacteria | 4578 | Open in IMG/M |
| 3300018049|Ga0181572_10927718 | Not Available | 514 | Open in IMG/M |
| 3300018413|Ga0181560_10119406 | Not Available | 1373 | Open in IMG/M |
| 3300018416|Ga0181553_10281841 | Not Available | 931 | Open in IMG/M |
| 3300018424|Ga0181591_11178244 | Not Available | 511 | Open in IMG/M |
| 3300018426|Ga0181566_10910329 | Not Available | 595 | Open in IMG/M |
| 3300020165|Ga0206125_10007049 | Not Available | 8881 | Open in IMG/M |
| 3300020165|Ga0206125_10008132 | Not Available | 7992 | Open in IMG/M |
| 3300020165|Ga0206125_10108132 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300020165|Ga0206125_10257504 | Not Available | 662 | Open in IMG/M |
| 3300020169|Ga0206127_1287363 | Not Available | 552 | Open in IMG/M |
| 3300020173|Ga0181602_10229430 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 804 | Open in IMG/M |
| 3300020173|Ga0181602_10287087 | Not Available | 686 | Open in IMG/M |
| 3300020174|Ga0181603_10300006 | Not Available | 620 | Open in IMG/M |
| 3300020175|Ga0206124_10053699 | Not Available | 1762 | Open in IMG/M |
| 3300020175|Ga0206124_10333649 | Not Available | 573 | Open in IMG/M |
| 3300020207|Ga0181570_10519310 | Not Available | 543 | Open in IMG/M |
| 3300020246|Ga0211707_1002606 | All Organisms → Viruses → Predicted Viral | 2918 | Open in IMG/M |
| 3300020247|Ga0211654_1013062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1359 | Open in IMG/M |
| 3300020258|Ga0211529_1023672 | Not Available | 1046 | Open in IMG/M |
| 3300020258|Ga0211529_1078158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300020264|Ga0211526_1064399 | Not Available | 621 | Open in IMG/M |
| 3300020267|Ga0211648_1031374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300020269|Ga0211484_1076274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300020274|Ga0211658_1090163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300020294|Ga0211520_1000162 | Not Available | 15459 | Open in IMG/M |
| 3300020299|Ga0211615_1006851 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300020336|Ga0211510_1016067 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
| 3300020365|Ga0211506_1022539 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300020365|Ga0211506_1099959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 821 | Open in IMG/M |
| 3300020373|Ga0211660_10099667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300020377|Ga0211647_10008855 | All Organisms → Viruses → Predicted Viral | 4406 | Open in IMG/M |
| 3300020385|Ga0211677_10235789 | Not Available | 748 | Open in IMG/M |
| 3300020388|Ga0211678_10037269 | All Organisms → Viruses → Predicted Viral | 2361 | Open in IMG/M |
| 3300020388|Ga0211678_10055313 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300020388|Ga0211678_10166114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 940 | Open in IMG/M |
| 3300020388|Ga0211678_10437128 | Not Available | 514 | Open in IMG/M |
| 3300020395|Ga0211705_10277646 | Not Available | 620 | Open in IMG/M |
| 3300020397|Ga0211583_10113521 | Not Available | 1012 | Open in IMG/M |
| 3300020402|Ga0211499_10213940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300020404|Ga0211659_10026055 | All Organisms → Viruses → Predicted Viral | 2847 | Open in IMG/M |
| 3300020408|Ga0211651_10318177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300020410|Ga0211699_10079012 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300020413|Ga0211516_10007379 | Not Available | 6917 | Open in IMG/M |
| 3300020413|Ga0211516_10074224 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
| 3300020416|Ga0211644_10015317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3155 | Open in IMG/M |
| 3300020419|Ga0211512_10062997 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| 3300020420|Ga0211580_10388877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300020422|Ga0211702_10169027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300020430|Ga0211622_10133690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1069 | Open in IMG/M |
| 3300020435|Ga0211639_10262664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300020436|Ga0211708_10046255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1674 | Open in IMG/M |
| 3300020438|Ga0211576_10024541 | All Organisms → Viruses → Predicted Viral | 3615 | Open in IMG/M |
| 3300020442|Ga0211559_10136641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1171 | Open in IMG/M |
| 3300020445|Ga0211564_10001645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 11391 | Open in IMG/M |
| 3300020446|Ga0211574_10421128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300020448|Ga0211638_10019486 | All Organisms → Viruses → Predicted Viral | 2870 | Open in IMG/M |
| 3300020449|Ga0211642_10226006 | Not Available | 806 | Open in IMG/M |
| 3300020466|Ga0211714_10278510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300020469|Ga0211577_10258931 | Not Available | 1118 | Open in IMG/M |
| 3300020470|Ga0211543_10102291 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300020471|Ga0211614_10363737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300020478|Ga0211503_10232484 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300021347|Ga0213862_10155712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300021365|Ga0206123_10078113 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300021371|Ga0213863_10432874 | Not Available | 526 | Open in IMG/M |
| 3300021373|Ga0213865_10028652 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 3128 | Open in IMG/M |
| 3300021373|Ga0213865_10302410 | Not Available | 745 | Open in IMG/M |
| 3300021373|Ga0213865_10470954 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 542 | Open in IMG/M |
| 3300021378|Ga0213861_10113878 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300021379|Ga0213864_10146610 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
| 3300021389|Ga0213868_10237322 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300021442|Ga0206685_10002197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5933 | Open in IMG/M |
| 3300021957|Ga0222717_10244853 | Not Available | 1044 | Open in IMG/M |
| 3300021957|Ga0222717_10330852 | Not Available | 861 | Open in IMG/M |
| 3300021964|Ga0222719_10013469 | Not Available | 6678 | Open in IMG/M |
| 3300022074|Ga0224906_1125004 | Not Available | 741 | Open in IMG/M |
| 3300022187|Ga0196899_1202567 | Not Available | 525 | Open in IMG/M |
| 3300022907|Ga0255775_1056478 | Not Available | 1914 | Open in IMG/M |
| 3300022907|Ga0255775_1319589 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 532 | Open in IMG/M |
| 3300022935|Ga0255780_10179012 | Not Available | 1121 | Open in IMG/M |
| 3300022935|Ga0255780_10436795 | Not Available | 569 | Open in IMG/M |
| 3300022937|Ga0255770_10073178 | Not Available | 2060 | Open in IMG/M |
| 3300022937|Ga0255770_10118147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
| 3300023081|Ga0255764_10296833 | Not Available | 742 | Open in IMG/M |
| 3300023084|Ga0255778_10079561 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
| 3300023115|Ga0255760_10241070 | Not Available | 931 | Open in IMG/M |
| 3300023175|Ga0255777_10515593 | Not Available | 614 | Open in IMG/M |
| 3300023273|Ga0255763_1006144 | Not Available | 9337 | Open in IMG/M |
| 3300024185|Ga0228669_1091588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300024242|Ga0228673_1012614 | Not Available | 1538 | Open in IMG/M |
| 3300024314|Ga0228657_1069958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300024314|Ga0228657_1100736 | Not Available | 575 | Open in IMG/M |
| 3300024319|Ga0228670_1016478 | Not Available | 1968 | Open in IMG/M |
| 3300024326|Ga0228652_1059850 | All Organisms → Viruses | 960 | Open in IMG/M |
| 3300024344|Ga0209992_10422958 | Not Available | 522 | Open in IMG/M |
| 3300025084|Ga0208298_1023791 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300025132|Ga0209232_1155907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 726 | Open in IMG/M |
| 3300025137|Ga0209336_10088836 | All Organisms → Viruses | 890 | Open in IMG/M |
| 3300025138|Ga0209634_1038057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2477 | Open in IMG/M |
| 3300025138|Ga0209634_1053655 | All Organisms → Viruses → Predicted Viral | 1976 | Open in IMG/M |
| 3300025168|Ga0209337_1009337 | Not Available | 6305 | Open in IMG/M |
| 3300025168|Ga0209337_1089537 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300025626|Ga0209716_1061350 | Not Available | 1192 | Open in IMG/M |
| 3300025645|Ga0208643_1012919 | All Organisms → Viruses → Predicted Viral | 3121 | Open in IMG/M |
| 3300025645|Ga0208643_1102378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300025645|Ga0208643_1136113 | Not Available | 636 | Open in IMG/M |
| 3300025696|Ga0209532_1111178 | Not Available | 917 | Open in IMG/M |
| 3300025712|Ga0209305_1183762 | Not Available | 621 | Open in IMG/M |
| 3300026500|Ga0247592_1040335 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1139 | Open in IMG/M |
| 3300026513|Ga0247590_1079763 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 848 | Open in IMG/M |
| 3300027830|Ga0209359_10119584 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300027906|Ga0209404_10093462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
| 3300027917|Ga0209536_100404388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1706 | Open in IMG/M |
| 3300028127|Ga0233401_1048099 | All Organisms → Viruses | 1049 | Open in IMG/M |
| 3300028273|Ga0228640_1024188 | Not Available | 1187 | Open in IMG/M |
| 3300029792|Ga0183826_1010868 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300031519|Ga0307488_10281692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300032006|Ga0310344_11728520 | Not Available | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 20.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.34% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.79% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.66% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 3.77% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.02% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.64% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.64% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.26% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.26% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.26% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.89% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.13% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume | 1.13% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.13% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.75% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.75% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.38% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.38% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.38% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.38% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.38% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.38% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.38% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 0.38% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.38% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300001392 | ELSC Metagenome | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001515 | Hydrothermal vent plume microbial communities from Kilo Moana, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
| 3300001516 | Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
| 3300001680 | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003086 | Marine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin | Environmental | Open in IMG/M |
| 3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003585 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006077 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid B | Environmental | Open in IMG/M |
| 3300006079 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007510 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007755 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008627 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016787 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071411AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020299 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020373 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020435 | Marine microbial communities from Tara Oceans - TARA_B100000586 (ERX556070-ERR599086) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
| 3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100217585 | 3300000101 | Marine | MDLSFITADLLNNISWWDGIIYILIALVVYALIRWINKKI* |
| DelMOSum2010_101876812 | 3300000101 | Marine | MDLSFITADLLNDISWFDGIMYIILGLVVYTAIRYINKKI* |
| DelMOSum2010_101940892 | 3300000101 | Marine | MDLSFITADLLNDISWFDGIIYIILGLVVYTAIRYINKKI* |
| DelMOSum2011_100611921 | 3300000115 | Marine | TADLLNDISWFDGIIYIILGLVVYAAIRYINKKI* |
| DelMOWin2010_101280462 | 3300000117 | Marine | MDLSFITADLLNDISWFDGIXYIILGLVVYTAIRYINKKI* |
| LPjun09P1210mDRAFT_10059972 | 3300000168 | Marine | MIDITADLLNNISWEDGIIYIILGLLVYTAKKYIDKRFK* |
| Lau_100683996 | 3300001392 | Black Smokers Hydrothermal Plume | MKDLSFITADLLNDISWIDGIIYILLGLVVYATIKYINKKVK* |
| JGI24006J15134_100396374 | 3300001450 | Marine | MDLSFITADLLNNISWFDGIIYIILSLVAYAIVRYINKKIK*IHKLST |
| KiloMoana_10600641 | 3300001515 | Hydrothermal Vent Plume | ITADLLNDISWIDGIIYILLGLVVYATIKYINKKVK* |
| KiloMoana_10976203 | 3300001515 | Hydrothermal Vent Plume | MDLSFITAELLNDISWLDGIIYILLGLGVYATIRYINKKI* |
| TahiMoana_11423941 | 3300001516 | Hydrothermal Vent Plume | VMDLTFITAELLNDISWFDGIVYIILGLGIYAIIKYINNIFR* |
| KiloMoana_100484465 | 3300001680 | Black Smokers Hydrothermal Plume | MDLTFITAELLNDISWFDGIVYIILGLGIYAIIKYINNIFR* |
| GOS2217_101291432 | 3300001973 | Marine | MNLSFITADLLNNISWEDGIIYIILGLIVYAVIRYINKKI* |
| GOS2246_100110213 | 3300001974 | Marine | MDLRFITADLLNDIAWFDGIMYIILGLVVYALIRYINKKI* |
| JGI25132J35274_10539302 | 3300002483 | Marine | MIDITAELLNDIPWFDGIIYIILGLLIYTAKKYIDKKFK* |
| Ga0052187_1004590 | 3300003086 | Hydrothermal Vent Plume | MDLTFITAELLNDISWFDGIAYTVLGLVVYAVAKYINTKIN* |
| Ga0052187_10081127 | 3300003086 | Hydrothermal Vent Plume | MDLRFITAELLNDISWFDGIMYIILGIGIYAIIKYINTKIN* |
| JGI26064J46334_10683822 | 3300003185 | Marine | MDLSFITADLLNEIGWFDGIMYIILGLVVYAAIRYINKKI* |
| NAP4_10777692 | 3300003474 | Estuarine | MDLSFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI* |
| JGI26249J51723_10409153 | 3300003585 | Marine | MDLSFITADFLNNISWWDGIIYIIMALVVYALIRWINKKI* |
| Ga0055584_1005075573 | 3300004097 | Pelagic Marine | MDLSFITADLLNNISWEDGIIYIILALAVYAAVRWINKKIK* |
| Ga0068511_10463092 | 3300005057 | Marine Water | MDLSFITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI* |
| Ga0073579_11037862 | 3300005239 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKIK* |
| Ga0073579_11821141 | 3300005239 | Marine | MIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDKRFK* |
| Ga0066845_101416901 | 3300005432 | Marine | MIDITAELLNDIPWFDGIIYIILGLLVYTAKKYIDKKFK* |
| Ga0076923_1207492 | 3300005735 | Marine | MDLSFITADLLNEISWFDGSVYILLGLAVYVAVRYINKKIR* |
| Ga0076924_104689510 | 3300005747 | Marine | MDLSFITADLLNDISWFDGIMYIILGLVVYAIIRWINKKI* |
| Ga0066370_100182245 | 3300005971 | Marine | MNLSFITADLLNNISWEDGIIYIILGLVVYAVIRYINKKI* |
| Ga0066371_101536411 | 3300006024 | Marine | MDLSFITADLLNNISWEDGIIYIVLGLVVYAAIRYINKKI* |
| Ga0066371_102397132 | 3300006024 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVIYALVKYINKKI* |
| Ga0081594_100136436 | 3300006077 | Diffuse Hydrothermal Fluid | MDLRFITAELLNDISWIDGIVYILMGLGIYAIIRYINTRIK* |
| Ga0081594_10030944 | 3300006077 | Diffuse Hydrothermal Fluid | MDLSFITADLLNNISWFDGVVYIVLGLGIYTTIKYINKKM* |
| Ga0081594_100311526 | 3300006077 | Diffuse Hydrothermal Fluid | MDLTFITAELLNDISWIDGIIYICLGLSTYAIARYINKKI* |
| Ga0081594_100317813 | 3300006077 | Diffuse Hydrothermal Fluid | MDLNFITAELLNGISWFDGIIYIVLGLGVYAVVKYINTKIN* |
| Ga0081594_100332817 | 3300006077 | Diffuse Hydrothermal Fluid | MDLSFITADLLNDISWFDGIVYIVLGLGVYTAIRIINKKIK* |
| Ga0081594_100602212 | 3300006077 | Diffuse Hydrothermal Fluid | MDLRFITAELLNDISWFDGIMYIILGIGIYAIIKYINAKIK* |
| Ga0081594_10404099 | 3300006077 | Diffuse Hydrothermal Fluid | MDLNFITAELLNAISWIDGIMYIILGIGVYTVVRYINTKM* |
| Ga0081594_11541372 | 3300006077 | Diffuse Hydrothermal Fluid | MNINAELLNSISWFDGIIYIVLGIGVYAVVKYINTKIN* |
| Ga0081594_11607563 | 3300006077 | Diffuse Hydrothermal Fluid | MDLSFITADLLNNISWLDGIIYILLGLGVYATIRYINKKI* |
| Ga0081601_11287243 | 3300006079 | Diffuse Hydrothermal Fluid | MDLNFITAELLNGISWFDGIIYIVLGLGVYAVAKYINTKM* |
| Ga0066836_106683752 | 3300006166 | Marine | MIDITADLLNSISWEDGIIYIILGLLIYATKKYIDKRFK* |
| Ga0068500_13586442 | 3300006332 | Marine | MDLSFITADLLNEISWFDGIMYIILGLVVYAAIRYINKKI* |
| Ga0068500_14106312 | 3300006332 | Marine | MDLSFITADLLNNISWEDGIIYIVLGLIVYAAIRYINKKI* |
| Ga0099675_10437311 | 3300006334 | Marine | MIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDNKFK* |
| Ga0099675_10540812 | 3300006334 | Marine | MNLSFITADLLNEVGWFDGIMYIILGLIVYAVIRYINKKI* |
| Ga0075514_17774211 | 3300006403 | Aqueous | ADLLNNISWEDGIIYIILALAVYAAVRWINKKIK* |
| Ga0100228_11699632 | 3300006565 | Marine | LSFITADLLNEIGWFDGIMYIILGLVVYAAIRYINKKI* |
| Ga0098037_10071813 | 3300006737 | Marine | MIDITSDLLNSISWEDGIIYIILGLLVYTAKKYIDKKFK* |
| Ga0098042_10141274 | 3300006749 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIIRYINKKI* |
| Ga0098042_10528632 | 3300006749 | Marine | MDLSFITADLLNDVSWFDGIIYIILGLVVYAAIRYINKKI* |
| Ga0098055_10210065 | 3300006793 | Marine | MDLSFITADLLNNISWWDGIIYILMALVVYALIRWINKKI* |
| Ga0070749_100696994 | 3300006802 | Aqueous | MDLSFITADLLNNISWFDGIMYIILGLIVYAIIRWINKKI* |
| Ga0070749_103347232 | 3300006802 | Aqueous | MDLSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI* |
| Ga0066372_102654532 | 3300006902 | Marine | MDLSFITADLLNEISWEDGIIYIILGLLVYAVIRYINKKI* |
| Ga0098051_10529481 | 3300006924 | Marine | MDLSFITADLLNDISWFDGIIYIILGLVVYAAVRYINKKI* |
| Ga0101666_10128014 | 3300007113 | Volcanic Co2 Seep Seawater | MDLSFITADLLNDISWFDGIIYIILGLIVYAAIRYINKKI* |
| Ga0105013_10298313 | 3300007510 | Marine | MDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINVKIK* |
| Ga0102948_11357492 | 3300007623 | Water | MDLSFITADLLNNISWEDGIIYIILALAVYATVRWINKKIK* |
| Ga0105014_10591291 | 3300007755 | Marine | LSFITADLLNNISWFDGIVYIILGLGIYSAIRLITVK* |
| Ga0102954_11449093 | 3300007778 | Water | MDLSFITADLLNNISWEDGIIYIILAIAVYAAVRWINKKIK* |
| Ga0115656_10315538 | 3300008627 | Marine | MDLSFITADLLNNISWFDGISYIILGLITYAIFRWINT |
| Ga0115650_10402746 | 3300008954 | Marine | MDLSFITADLLNNISWFDGISYIILGLITYAIFRWINTKIK* |
| Ga0102963_10435743 | 3300009001 | Pond Water | MDLSFITADLLNNISWEDGIIYIILALAVYTAVRWINKKIK* |
| Ga0115566_102410512 | 3300009071 | Pelagic Marine | MDLRFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIK* |
| Ga0117901_13274812 | 3300009103 | Marine | MDLSFITADLLNEISWEDGIIYIILGLIVYAAIRYINKKI* |
| Ga0114996_105893662 | 3300009173 | Marine | ADLLNEISWFDGIIYIILSLVAYAIVRCINKKIK* |
| Ga0114996_112692712 | 3300009173 | Marine | MDLSFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIK* |
| Ga0115548_10512031 | 3300009423 | Pelagic Marine | KIMDLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKIK* |
| Ga0115548_10759174 | 3300009423 | Pelagic Marine | MDLSFITADLLNDISWFDGIIYIILGLIIYAAVRYINKKI* |
| Ga0114997_101600632 | 3300009425 | Marine | MDLSFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKI* |
| Ga0115008_100470473 | 3300009436 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKI* |
| Ga0114932_100293214 | 3300009481 | Deep Subsurface | MDLRFITADLLNDISWFDGIMYIILGLVVYAIIRYINKKI* |
| Ga0114932_102786142 | 3300009481 | Deep Subsurface | MDLRFITPDLLNDISWFDGIMYIILGLVIYAIVRYINKKI* |
| Ga0115567_101332642 | 3300009508 | Pelagic Marine | MDFSFITADLLNDISWFDGIMYIILGLVVYTAIRYINKKI* |
| Ga0115006_112573011 | 3300009544 | Marine | KIMDLRFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIK* |
| Ga0115013_104144862 | 3300009550 | Marine | MDLSFITADLLNDISWFDGIMYIILGLVVYSAIRYINKKI* |
| Ga0115013_105316042 | 3300009550 | Marine | MDLSFITADLLNDISWFGGIIYIILGLVVYAAIRYINKKI* |
| Ga0115011_100499254 | 3300009593 | Marine | MIDITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK* |
| Ga0115000_106593521 | 3300009705 | Marine | GEIIMDLSFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI* |
| Ga0115012_114738891 | 3300009790 | Marine | ADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK* |
| Ga0098043_11977211 | 3300010148 | Marine | KIMDLSFITADLLNNISWFDGIMYILLGLVVYAIVRWINKKI* |
| Ga0133547_119082602 | 3300010883 | Marine | ADLLNNISWEDGIIYIILGLLVYTAKKYIDKRFK* |
| Ga0151671_11149562 | 3300011253 | Marine | MDLRFIKADLLNEISWFDGIIYIILSLVAYAIVRYINKKIK* |
| Ga0151677_10878741 | 3300011258 | Marine | MIDITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKF |
| Ga0160423_1000168110 | 3300012920 | Surface Seawater | MIDITAELLNDIPWFDGIIYIILIIALYILKKIIDKRF* |
| Ga0160423_100377555 | 3300012920 | Surface Seawater | MDLSFITADLLNEISWFDGIMYIILGLIVYTAIRYINKKI* |
| Ga0160423_104042851 | 3300012920 | Surface Seawater | ITADLLNNISWEDGIIYIILGLIVYAVIRYINKKI* |
| Ga0163110_100202196 | 3300012928 | Surface Seawater | MNLSFITADLLNNISWEDGIIYIILGLIVYAVVRYINKKI* |
| Ga0163110_102010682 | 3300012928 | Surface Seawater | MIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK* |
| Ga0163180_100456613 | 3300012952 | Seawater | MIDITAELLNDIPWFDGIIYIILGLPIYTAKKYIDKKFK* |
| Ga0163180_101667453 | 3300012952 | Seawater | IKMIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDKRFK* |
| Ga0163180_105850183 | 3300012952 | Seawater | MDLSFITADLLNEISWFDGIIYIILGLIIYAAVRYINKKI* |
| Ga0163180_111970222 | 3300012952 | Seawater | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIVRYINKKI* |
| Ga0163179_100600633 | 3300012953 | Seawater | MIDITADLLNEIPWFDGIIYIILGLLVYTAKKYIDKKFK* |
| Ga0163179_100674081 | 3300012953 | Seawater | IIMDLSFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI* |
| Ga0163179_104130162 | 3300012953 | Seawater | MDLSFITADLLNDISWFDGIMYIILFLIVYSAIRYINKKI* |
| Ga0163111_100773443 | 3300012954 | Surface Seawater | MDLRFITPDLLNDISWFDGIMYIILGLVVYALIRYINKKI* |
| Ga0182074_10326983 | 3300016735 | Salt Marsh | FITADLLNNISWEDGIIYIILGLAVYAAVRWINKKIK |
| Ga0182082_15957121 | 3300016771 | Salt Marsh | VDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINIKIK |
| Ga0182080_14060881 | 3300016787 | Salt Marsh | MDLSFITADLLNEISWIDGIDYIILGIITYAVIRW |
| Ga0182095_10732061 | 3300016791 | Salt Marsh | PQSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0182090_14797401 | 3300016797 | Salt Marsh | KMDLSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0182090_17795131 | 3300016797 | Salt Marsh | TTGTHSIMDLSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0181369_11083691 | 3300017708 | Marine | TADLLNSISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0181373_10281974 | 3300017721 | Marine | MDLSFITADLLNDISWFDGIIYIILGLVVYAAVRYINK |
| Ga0181417_11625961 | 3300017730 | Seawater | EIIMDLSFITADLLNDISWFDGIMYIILGLIIYAAVRYINKKI |
| Ga0181417_11640431 | 3300017730 | Seawater | IMDLSFITADLLNDISWFDGIIYIILGLVVYAAVRYINKKI |
| Ga0181416_11431681 | 3300017731 | Seawater | MDLSFITADLLNDISWFDGIIYIILGHVVYAAVRYINKKI |
| Ga0181415_10271612 | 3300017732 | Seawater | MDLSFITADLLNDISWFDGIMYIILGLIIYAAVRYINKKI |
| Ga0181431_10431654 | 3300017735 | Seawater | MDLSFITADLLNDISWFDGIIYIILGLVVYAAIRYINK |
| Ga0181433_10701001 | 3300017739 | Seawater | ITADLLNSISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0181397_11228492 | 3300017744 | Seawater | KNKIMDLSFITADLLNNISWFDGIIYIILGLVVYAIVRWINKKI |
| Ga0181427_10126334 | 3300017745 | Seawater | GIIKMIDITADLLNEILWFDGIIYIILGLLICTAKKYIDKKFK |
| Ga0181392_12092522 | 3300017749 | Seawater | GEIIMDLSFITADLLNDISWFDGIMYIILSLVVYAAIRYINKKI |
| Ga0181409_10411814 | 3300017758 | Seawater | IKMIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0181408_10531021 | 3300017760 | Seawater | MDLSFITADLLNDISWFDGIIYIILGLVVYAAIRYI |
| Ga0187217_11608892 | 3300017770 | Seawater | MDLSFITADLLNDISWFDGIMYIILSLVVYAAIRYINKKI |
| Ga0181432_12302282 | 3300017775 | Seawater | MIDITADLLNSISWEDGIIYIILGLLVYAVKKYIDKRFK |
| Ga0181379_12021833 | 3300017783 | Seawater | IKMIDITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0181565_100083474 | 3300017818 | Salt Marsh | MDLSFITADLLNEISWFDGIGYIILGVITYAVIRWINIKIK |
| Ga0181565_100284856 | 3300017818 | Salt Marsh | MMSLVWSMPKMDLSFITADLLNNISWFDGIMYIVLGLIVYAIIRWINKKI |
| Ga0181565_106305432 | 3300017818 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGIITYAVIRWINIKIK |
| Ga0181552_100336264 | 3300017824 | Salt Marsh | MIDITAELLNDIPWFDGIIYIILGLLIYAAKKYIDKRFK |
| Ga0181552_101050915 | 3300017824 | Salt Marsh | MDLSFITADLLNDISWFDGIMYIILGLVVYAIIRWINKKI |
| Ga0181584_100103596 | 3300017949 | Salt Marsh | MDLSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0181584_101669593 | 3300017949 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGIITYAVIRWINVKIK |
| Ga0181584_103770203 | 3300017949 | Salt Marsh | SFITADLLNEISWIDGIGYIILGVITYAVIRWINVKIK |
| Ga0181584_103800931 | 3300017949 | Salt Marsh | IMDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINVKIK |
| Ga0181584_107945141 | 3300017949 | Salt Marsh | MDLSFITADLLNNISWEDGIIYIILALAVYAAVRWINKKIK |
| Ga0181607_1000890314 | 3300017950 | Salt Marsh | MDLSFITADLLNNISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0181607_100284536 | 3300017950 | Salt Marsh | MDLSFITADFLNNISWFDGIMYIILLLIVYAAIKWINKKI |
| Ga0181607_100491834 | 3300017950 | Salt Marsh | MDLSFITADLLNDISWFDGIMYIILLLIVYAAIKWINTRIK |
| Ga0181607_104811181 | 3300017950 | Salt Marsh | MDLSFITADLLNNISWEDGIIYIILALVVYAAVRWINKNIK |
| Ga0181577_101243433 | 3300017951 | Salt Marsh | MPKMDLSFITADLLNNISWFDGIMYIVLGLIVYAIIRWINKKI |
| Ga0181580_101505493 | 3300017956 | Salt Marsh | MSITADLLNSISWEDGIIYIILGLLVYAAKKYIDKKFK |
| Ga0181580_101967833 | 3300017956 | Salt Marsh | SFITADLLNEISWIDGIGYIILGIITYAVIRWINVKIK |
| Ga0181580_103653272 | 3300017956 | Salt Marsh | ITADLLNNISWEDGIIYIILGLAVYAAVRWINKKIK |
| Ga0181582_100265489 | 3300017958 | Salt Marsh | MDLSFITADLLNEISWFDGIMYIILGLVVYAIIRWINKKI |
| Ga0181582_101011455 | 3300017958 | Salt Marsh | MDLSFITSDLLNEISWIDGIGYIILGIITYAVIRWINVKIK |
| Ga0181582_101335634 | 3300017958 | Salt Marsh | IMDLSFITADLLNDISWFDGIMYIILGLVVYAIISWINKKI |
| Ga0181581_100691212 | 3300017962 | Salt Marsh | MNITADLLNSISWEDGIIYIILGLLVYAAKKYIDKKFK |
| Ga0181581_102183933 | 3300017962 | Salt Marsh | SMDLSFITADLLNNISWEDGIIYIILGLAVYAAVRWINKKIK |
| Ga0181589_109199491 | 3300017964 | Salt Marsh | LSFITADLLNNISWEDGIIYIILGLAVYAAVRWINKKIK |
| Ga0181585_102917593 | 3300017969 | Salt Marsh | SFITADLLNEISWIDGIGYIILGVITYAAIRWINVKIK |
| Ga0181576_103200093 | 3300017985 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINIKIK |
| Ga0181600_104271331 | 3300018036 | Salt Marsh | THSIMDLSFITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0181572_100191354 | 3300018049 | Salt Marsh | MIDITAELLNDIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0181572_109277181 | 3300018049 | Salt Marsh | MDLSFITADFLNNISWFDGIMYIILLLIVYAAIKW |
| Ga0181560_101194064 | 3300018413 | Salt Marsh | RQIGDIIMDLSFITADFLNNISWFDGIMYIILLLIVYAAIKWINKKI |
| Ga0181553_102818411 | 3300018416 | Salt Marsh | MDLSFITADLLNDISWFDGIMYIILGLIVYAIIRW |
| Ga0181591_111782441 | 3300018424 | Salt Marsh | TADLLNNISWEDGIIYIILGLAVYAAVRWINKKIK |
| Ga0181566_109103292 | 3300018426 | Salt Marsh | MDLSFITADLLNNISWEDGIIYIILGLAVYAAVRWINKKI |
| Ga0206125_1000704911 | 3300020165 | Seawater | MDLSFITADLLNNISWWDGIIYILMALVVYALIRWINKKI |
| Ga0206125_100081324 | 3300020165 | Seawater | MDLSFITADFLNNISWWDGIIYIIMALVVYALIRWINKKI |
| Ga0206125_101081323 | 3300020165 | Seawater | MDLSFITADLLNDISWFDGIMYIILGLVVYTAIRYINKKI |
| Ga0206125_102575042 | 3300020165 | Seawater | MDLSFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI |
| Ga0206127_12873632 | 3300020169 | Seawater | MDLSFITADLLNDISWFDGIMYIILGLVVYTAIRY |
| Ga0181602_102294303 | 3300020173 | Salt Marsh | ITADLLNDISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0181602_102870871 | 3300020173 | Salt Marsh | IMDLSFITADLLNDISWFDGIMYIILGLVVYAIIRWINKKI |
| Ga0181603_103000061 | 3300020174 | Salt Marsh | LSFITADLLNNISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0206124_100536993 | 3300020175 | Seawater | MDLSFITADLLNDISWFDGIMYIILGLVVYALIRWINKKI |
| Ga0206124_103336491 | 3300020175 | Seawater | DLSFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI |
| Ga0181570_105193101 | 3300020207 | Salt Marsh | MDLSFITSDLLNEISWIDGIGYIILGIITYAVIRWI |
| Ga0211707_10026065 | 3300020246 | Marine | MNLSFITADLLNNISWEDGIIYIILGLIVYAVIRYINKKI |
| Ga0211654_10130622 | 3300020247 | Marine | MDLSFITADLLNDVSWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0211529_10236722 | 3300020258 | Marine | MDLSFITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0211529_10781581 | 3300020258 | Marine | ITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211526_10643992 | 3300020264 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIIRYINKKI |
| Ga0211648_10313743 | 3300020267 | Marine | MIDITAELLNDIPWFDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0211484_10762742 | 3300020269 | Marine | MIDITADLLNEIPWFDGMIYIILGLLIYTAKKYIDKKFK |
| Ga0211658_10901632 | 3300020274 | Marine | MIDITSELLNDIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211520_10001623 | 3300020294 | Marine | MIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDKRFK |
| Ga0211615_10068512 | 3300020299 | Marine | MIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211510_10160675 | 3300020336 | Marine | MDLSFITADLLNDISWFDGIMYIILGLVVYSAIRYINKKI |
| Ga0211506_10225394 | 3300020365 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVIYAIIRYINKKI |
| Ga0211506_10999592 | 3300020365 | Marine | MIDITAELLNDIPWFDGIIYIILIIALYILKKIIDKRF |
| Ga0211660_100996672 | 3300020373 | Marine | MIDITADLLNSISWEDGIIYIILGLLIYATKKYIDKRFK |
| Ga0211647_100088554 | 3300020377 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYTLVRYINKKI |
| Ga0211677_102357891 | 3300020385 | Marine | SFITADLLNDISWFDGIIYIILGLVVYAAVRYINKKI |
| Ga0211678_100372692 | 3300020388 | Marine | MDLSFITADLLNDISWFDGIIYIILGLVVYAAVRYINKKI |
| Ga0211678_100553132 | 3300020388 | Marine | MDLSFITADLLNNISWFDGIIYIILGLVVYAIVRWINKKI |
| Ga0211678_101661141 | 3300020388 | Marine | MIDITADLLNNISWEDGIIYIILGLLVYTAKKYIDKRFK |
| Ga0211678_104371282 | 3300020388 | Marine | SFITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0211705_102776461 | 3300020395 | Marine | MNLSFITADLLNEISWFDGIMYIILGLIVYAVIRYINKKI |
| Ga0211583_101135213 | 3300020397 | Marine | MDLSFITADLLNDISWFDGIIYIILGLIVYAAIRYINKKI |
| Ga0211499_102139401 | 3300020402 | Marine | KMIDITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211659_100260551 | 3300020404 | Marine | MIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0211651_103181772 | 3300020408 | Marine | MIDITADLLNEIPWFDGIIYIILGLLVYTAKKYIDKK |
| Ga0211699_100790123 | 3300020410 | Marine | MNLSFITADLLNEVGWFDGIMYIILGLIVYAVIRYINKKI |
| Ga0211516_100073793 | 3300020413 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYAIIRYINKKI |
| Ga0211516_100742242 | 3300020413 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIVRYINKKI |
| Ga0211644_100153173 | 3300020416 | Marine | MQCGDIKMIDITAELLNEVPWFDGIIYIILGLLIYVAKKYIDNKFK |
| Ga0211512_100629974 | 3300020419 | Marine | MIDITAELLNDIPWFDGIIYIILGLLIYTAKKYIDK |
| Ga0211580_103888772 | 3300020420 | Marine | MIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDNKFK |
| Ga0211702_101690271 | 3300020422 | Marine | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIVKYINKKI |
| Ga0211622_101336902 | 3300020430 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYALIRYINKKI |
| Ga0211639_102626642 | 3300020435 | Marine | MIDITADLLNSISWEDGIIYIILGLLVYTAKKYIDK |
| Ga0211708_100462552 | 3300020436 | Marine | MDLSFITADLLNDISWFDGIMYIILGLVIYALVKYINKKI |
| Ga0211576_100245413 | 3300020438 | Marine | MDLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKI |
| Ga0211559_101366412 | 3300020442 | Marine | MDLSFITADLLNEISWFDGIMYIILGLIVYTAIRYINKKI |
| Ga0211564_1000164516 | 3300020445 | Marine | MDLSFITADLLNEISWEDGIIYIILGLIVYAAIRYINKKI |
| Ga0211574_104211283 | 3300020446 | Marine | KMIDITAELLNDIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211638_100194866 | 3300020448 | Marine | MQCGDIKMIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211642_102260061 | 3300020449 | Marine | MDLRFITADLLNDIPWFDGIMYIILGLVVYALIRYINKKI |
| Ga0211714_102785101 | 3300020466 | Marine | CGDIKMIDITAELLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0211577_102589312 | 3300020469 | Marine | MDLSFITADLLNNISWFDGIMYIILGLVVYAIVRYINKKIK |
| Ga0211543_101022914 | 3300020470 | Marine | MDLSFITADLLNDISWEDGIIYIILGLIVYAAVRYINKKI |
| Ga0211614_103637371 | 3300020471 | Marine | MIDITAELLNEIPWFDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0211503_102324842 | 3300020478 | Marine | LSFITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0213862_101557121 | 3300021347 | Seawater | DITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0206123_100781133 | 3300021365 | Seawater | MDLSFITADLLNDISWWDGIIYILMALVVYALIRWINKKI |
| Ga0213863_104328741 | 3300021371 | Seawater | MDLSFITADLLNDISWFDGIIYIILGLVVYATIRYINKKI |
| Ga0213865_100286522 | 3300021373 | Seawater | MDLSFITADLLNEISWFDGSVYILLGLAVYVAVRYINKKIR |
| Ga0213865_103024103 | 3300021373 | Seawater | MDLRFITPDLLNDISWFDGIMYIILGLVVYAIIKYINKKI |
| Ga0213865_104709542 | 3300021373 | Seawater | MNITSDLLNNISWEDGIIYIILGLLVYAAKKYIDKKLK |
| Ga0213861_101138782 | 3300021378 | Seawater | MDLSFITADLLNDISWFDGIIYIILGLVVYTAIRYINKKI |
| Ga0213864_101466102 | 3300021379 | Seawater | MNITSELLNNISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0213868_102373222 | 3300021389 | Seawater | MDLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKIK |
| Ga0206685_100021975 | 3300021442 | Seawater | MIDITADLLNSISWTDGIIYIILGLLVYAVKKYIDKRFK |
| Ga0222717_102448531 | 3300021957 | Estuarine Water | MDLSFITADFLNDISWFDGIIYIILLLGVYAAIKWINT |
| Ga0222717_103308522 | 3300021957 | Estuarine Water | MDLSFITADLLNNISWEDGIIYIILALAVYTAVRWINKKIK |
| Ga0222719_100134692 | 3300021964 | Estuarine Water | MDLSFITADLLNDISWFDGIMYIILGLIVYAIIKWINKKI |
| Ga0224906_11250042 | 3300022074 | Seawater | VMDLSFITADLLNDISWFDGIIYIILGLVVYAAVRYINKKI |
| Ga0196899_12025671 | 3300022187 | Aqueous | NTSMDLSFITADLLNNISWEDGIIYIILALAVYAAVRWINKKIK |
| Ga0255775_10564781 | 3300022907 | Salt Marsh | IHGGQVMDLSFITADLLNNISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0255775_13195892 | 3300022907 | Salt Marsh | ELELMNITSELLNNISWEDGIIYIILGLLVYTAKKYIDKKFK |
| Ga0255780_101790122 | 3300022935 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINVKIK |
| Ga0255780_104367951 | 3300022935 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINVK |
| Ga0255770_100731784 | 3300022937 | Salt Marsh | FITADLLNEISWIDGIGYIILGIITYAVIRWINVKIK |
| Ga0255770_101181473 | 3300022937 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGVITYAAIRWINVKIK |
| Ga0255764_102968331 | 3300023081 | Salt Marsh | MDLSFITADLLNEISWIDGIGYIILGVITYAAIRWINVK |
| Ga0255778_100795616 | 3300023084 | Salt Marsh | LSFITADLLNEISWFDGIMYIILGLVVYAIIRWINKKI |
| Ga0255760_102410701 | 3300023115 | Salt Marsh | ITADLLNEISWIDGIGYIILGVITYAVIRWINVKIK |
| Ga0255777_105155932 | 3300023175 | Salt Marsh | RNRQNRNQIMDLSFITADLLNEISWIDGIGYIILGVITYAVIRWINIKIK |
| Ga0255763_100614415 | 3300023273 | Salt Marsh | FITADLLNNISWFDGIMYIILGLIVYAIIRWINKKI |
| Ga0228669_10915882 | 3300024185 | Seawater | MIDITADLLNSISWEDGIIYIILGLLVYTEKKYIDKKFK |
| Ga0228673_10126141 | 3300024242 | Seawater | MDLSFITADFLNNISWWDGTIYILMALVVYALIRWINKKI |
| Ga0228657_10699583 | 3300024314 | Seawater | IMDLSFITADLLNNISWWDGIIYILMALVVYALIKWINKKI |
| Ga0228657_11007362 | 3300024314 | Seawater | MDLSWITADLLNNISWWDGIIYILMALVVYALIRWIN |
| Ga0228670_10164783 | 3300024319 | Seawater | MDLSFITADLLNNISWFDGIIYIILGLVVYAIVRWI |
| Ga0228652_10598502 | 3300024326 | Seawater | MDLSFITADLLNDISWFDGIIYIILGLIIYAAVRYINKKI |
| Ga0209992_104229582 | 3300024344 | Deep Subsurface | MDLRFITPDLLNDISWFDGIMYIILGLVIYAIVRYINKKI |
| Ga0208298_10237912 | 3300025084 | Marine | ITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0209232_11559073 | 3300025132 | Marine | MDLSFITADLLNDISWFDGIIYIILGLLVYIAKKYIDKKFK |
| Ga0209336_100888363 | 3300025137 | Marine | MDLSFITADLLNNISWFDGIIYIILSLVAYAIVRYINKKIKXIHKLST |
| Ga0209634_10380571 | 3300025138 | Marine | MDLSFITADLLNNISWFDGIIYIILSLVAYAIVRYINKKIKXIHKLSTKKL |
| Ga0209634_10536551 | 3300025138 | Marine | MDLRFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIKXIHKLSTKKL |
| Ga0209337_10093372 | 3300025168 | Marine | MDLSFITADLLNNISWFDGIIYIILSLVAYAIVRYINKKIK |
| Ga0209337_10895371 | 3300025168 | Marine | MDLSFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIKXIHKLSTKKL |
| Ga0209716_10613504 | 3300025626 | Pelagic Marine | MDLSFITADLLNDISWFDGIIYIILGLIIYAAVRYI |
| Ga0208643_10129194 | 3300025645 | Aqueous | FITADLLNDISWFDGIIYIILGLVVYAAIRYINKKI |
| Ga0208643_11023781 | 3300025645 | Aqueous | DLRFITADLLNDISWFDGIMYIILGLVVYAIVRYINKKIK |
| Ga0208643_11361132 | 3300025645 | Aqueous | SFITADLLNDISWFDGIMYIILGLVVYAAIRYINKKI |
| Ga0209532_11111784 | 3300025696 | Pelagic Marine | MDLSFITADLLNDISWFDGIMYIILGLVVYAAIRY |
| Ga0209305_11837621 | 3300025712 | Pelagic Marine | EIIMDLSFITADLLNDISWFDGIMYIILGLVVYTAIRYINKKI |
| Ga0247592_10403352 | 3300026500 | Seawater | MNITSDLLNNISWEDGIIYIILGLLVYAVKKYIDKKFE |
| Ga0247590_10797633 | 3300026513 | Seawater | MNITSDLLNNISWEDGIIYIILGLLVYAVKKYIDKKFK |
| Ga0209359_101195843 | 3300027830 | Marine | MDLSFITADLLNEIGWFDGIMYIILGLVVYAAIRYINKKI |
| Ga0209404_100934624 | 3300027906 | Marine | MIDITADLLNEIPWFDGIIYIILGLLIYTAKKYIDKKFK |
| Ga0209536_1004043882 | 3300027917 | Marine Sediment | MDLSFITADLLNNISWEDGIIYIILALVVYAAVRWINKKIK |
| Ga0233401_10480992 | 3300028127 | Seawater | MDLSFITADLLNDISLFDGIIYIILGLVVYAAIRYINKKI |
| Ga0228640_10241883 | 3300028273 | Seawater | MDLSFITADLLNNISWWDGIIYILMALVVYALIKWINKKI |
| Ga0183826_10108682 | 3300029792 | Marine | MDLSFITADLLNNISWEDGIIYIVLGLIVYAAIRYINKKI |
| Ga0307488_102816922 | 3300031519 | Sackhole Brine | MDLSFITADLLNEISWFDGIIYIILSLVAYAIVRYINKKIK |
| Ga0310344_117285202 | 3300032006 | Seawater | MNLSFITADLLNGVGWFDGIMYIILGLIVYAVIRYINKKI |
| ⦗Top⦘ |