Basic Information | |
---|---|
Taxon OID | 3300033757 Open in IMG/M |
Scaffold ID | Ga0373404_0081452 Open in IMG/M |
Source Dataset Name | Leachate microbial community from anaerobic digester in University of Toronto, Ontario, Canada - S62W2 SP |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1172 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Leachate → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Toronto, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071272 | Metagenome / Metatranscriptome | 122 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0373404_0081452_30_452 | F071272 | N/A | VFDKIISGEMKITDMDDWEIITRTAFSEWLRGLETAAKTRVYKAAVDHIADTMAAGAWQDGPAPKDGSWILGLFYGLPYVVCYDSWEISEEGGPKETEEGWCLAGQDMHPMDQDEPEKWARIIHPNRHMPASWDGPGDQR |
⦗Top⦘ |