NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373123_006

Scaffold Ga0373123_006


Overview

Basic Information
Taxon OID3300033746 Open in IMG/M
Scaffold IDGa0373123_006 Open in IMG/M
Source Dataset NameFracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOhio State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)275149
Total Scaffold Genes466 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (5.79%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040720Metagenome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0373123_006_85811_86026F040720N/AMRIYQLKTAEEFYKSISGNFTTAELMQMYAEDVAKRFAAECVNETLGNKMEVSNSLHSKIESKYRSIIWDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.