Basic Information | |
---|---|
Taxon OID | 3300033746 Open in IMG/M |
Scaffold ID | Ga0373123_006 Open in IMG/M |
Source Dataset Name | Fracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Ohio State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 275149 |
Total Scaffold Genes | 466 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (5.79%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: West Virginia | |||||||
Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | Depth (m) | 2281 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040720 | Metagenome | 161 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0373123_006_85811_86026 | F040720 | N/A | MRIYQLKTAEEFYKSISGNFTTAELMQMYAEDVAKRFAAECVNETLGNKMEVSNSLHSKIESKYRSIIWDN |
⦗Top⦘ |