


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300033746 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118431 | Gp0397573 | Ga0373123 |
| Sample Name | Fracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Ohio State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 11855729 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → gas well → fracking liquid |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | N/A | Depth (m) | 2281 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040720 | Metagenome | 161 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0373123_006 | All Organisms → cellular organisms → Bacteria | 275149 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0373123_006 | Ga0373123_006_85811_86026 | F040720 | MRIYQLKTAEEFYKSISGNFTTAELMQMYAEDVAKRFAAECVNETLGNKMEVSNSLHSKIESKYRSIIWDN |
| ⦗Top⦘ |