Sample 3300033746

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300033746

3300033746: Fracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016

Overview

Basic Information
IMG/M Taxon OID	3300033746 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118431 \| Gp0397573 \| Ga0373123
Sample Name	Fracking water microbial communities from gas well in Marcellus Shale, West Virginia, United States - MIP3H_02032016
Sequencing Status	Permanent Draft
Sequencing Center	Ohio State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	11855729
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → gas well → fracking liquid
Earth Microbiome Project Ontology (EMPO)	Unclassified

Location Information
Location	USA: West Virginia
Coordinates	Lat. (^o)	39.6017	Long. (^o)	-79.9761	Alt. (m)	N/A	Depth (m)	2281
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040720	Metagenome	161	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0373123_006	All Organisms → cellular organisms → Bacteria	275149	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0373123_006	Ga0373123_006_85811_86026	F040720	MRIYQLKTAEEFYKSISGNFTTAELMQMYAEDVAKRFAAECVNETLGNKMEVSNSLHSKIESKYRSIIWDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.