NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334887_1000984

Scaffold Ga0334887_1000984


Overview

Basic Information
Taxon OID3300033169 Open in IMG/M
Scaffold IDGa0334887_1000984 Open in IMG/M
Source Dataset NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_18_07-R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)40224
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (18.92%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Source Dataset Sampling Location
Location NameNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039153Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0334887_100098412F039153N/AMLYSVTTPEREQKYHTEVKFFNNSKQASLLNFSPLHKEIKKWAKSQGYIPKLYLRSAAVECINPCVLKEPECLMMDLIQVIANGQAYLIAVNIFGPSYDNNLHYILEEHAKERKAIYMKAECLDDVICEIQDNEHNHKGLPCVPDIKSRRSFQGDYSILFSPENLTWKTARYERA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.