NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315541_1000757

Scaffold Ga0315541_1000757


Overview

Basic Information
Taxon OID3300031586 Open in IMG/M
Scaffold IDGa0315541_1000757 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33253
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)53 (92.98%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.722Long. (o)-70.847Alt. (m)Depth (m)1.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046170Metagenome / Metatranscriptome151Y
F071959Metagenome / Metatranscriptome121Y
F074370Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0315541_100075749F074370AGGGGGMADEMAEKLAEAKKKMFGAQQPSGKIIMLVKGDTLFKCADPKVEVRQQE
Ga0315541_100075754F071959AGGAGGMASRNSLIHSNDMSLSDKKRYRLTALAAGLERTGHVNIGSINADVPGLQAIPDVNKAARVAAIAAYIETGAWPVTIDQRELAPLTDLVIAAAQDSWLTAALAVIGTAYTCLNAVAAPQLIVGKLMVCYAVSVESAVVPMPVSRLIFRKGGAVGNIQAQFDMEPMGVRLETDAFFSEPVIIDPNDVFAIQVLCRAIAVATRVHIHNFVYEASGTVIA
Ga0315541_100075755F046170AGGAGGMIRIEDFGEIGYGGAVTLTEWWDNKRIDEGKIGTKDVFKKASFYTYLGVGLAATLMSVFGWMRRYERWSEHVSHGFLYDVPRFAYNLTKALGAGSKRSGTESRAVSEAQRILNEKLRTKALTQGGGRTAERSYQREFESVAPYAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.