NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0246236_1010296

Scaffold Ga0246236_1010296


Overview

Basic Information
Taxon OID3300029893 Open in IMG/M
Scaffold IDGa0246236_1010296 Open in IMG/M
Source Dataset NameFracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2099
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → unclassified Fibrobacteria → Fibrobacteria bacterium GUT31(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Welkom
CoordinatesLat. (o)-28.232288Long. (o)26.794365Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016728Metagenome / Metatranscriptome245Y

Sequences

Protein IDFamilyRBSSequence
Ga0246236_10102963F016728AGGAVCVTCVWAGVDSLWEQEKLEARKMLENAAESHTSGARFVGKPFDLED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.