Basic Information | |
---|---|
Taxon OID | 3300029202 Open in IMG/M |
Scaffold ID | Ga0167843_100796 Open in IMG/M |
Source Dataset Name | Polluted lake sediment microbial communities from Telengana, India - LAKES1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8829 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Polluted Lake Sediment → Aquatic Microbial Community From Freshwater And Polluted Lake From Sweden And India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | India: Telengana | |||||||
Coordinates | Lat. (o) | 17.5741667 | Long. (o) | 78.3563333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090061 | Metagenome / Metatranscriptome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167843_1007967 | F090061 | AGAAGG | MISQNILKELNKTMIRYRAGLIDLQRCRQELSLLIAMLKAYEDTVMEEKLDRIQAILEER |
⦗Top⦘ |