NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256914_1000062

Scaffold Ga0256914_1000062


Overview

Basic Information
Taxon OID3300028908 Open in IMG/M
Scaffold IDGa0256914_1000062 Open in IMG/M
Source Dataset NameHydrothermal chimney microbial communities from Main Endeavour vent field at the Juan de Fuca Ridge, Pacific Ocean - Hulk
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)99765
Total Scaffold Genes89 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)78 (87.64%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Chimney → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location NamePacific Ocean: Juan de Fuca Ridge
CoordinatesLat. (o)47.5696Long. (o)-129.5902Alt. (m)Depth (m)2190
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052283Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0256914_100006262F052283AGGAGGMNPKQKSMLIGAIIGAALGAVGGYLFTRGLELPREEPARGFSFRKIPPGEMVALFISIMGVLRGLAELGERLEVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.