| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028908 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296323 | Ga0256914 |
| Sample Name | Hydrothermal chimney microbial communities from Main Endeavour vent field at the Juan de Fuca Ridge, Pacific Ocean - Hulk |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 555852493 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Chimney → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: Juan de Fuca Ridge | |||||||
| Coordinates | Lat. (o) | 47.5696 | Long. (o) | -129.5902 | Alt. (m) | N/A | Depth (m) | 2190 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052283 | Metagenome / Metatranscriptome | 143 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256914_1000062 | All Organisms → cellular organisms → Bacteria | 99765 | Open in IMG/M |
| Ga0256914_1033265 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256914_1000062 | Ga0256914_100006262 | F052283 | MNPKQKSMLIGAIIGAALGAVGGYLFTRGLELPREEPARGFSFRKIPPGEMVALFISIMGVLRGLAELGERLEVN |
| Ga0256914_1033265 | Ga0256914_10332653 | F052283 | MNPKQKSMLIGAVIGAALGAVGGYLFTRGLELPREDEPARGLSLRKVPPGEMVALFIAIMGVLRGLAELGERIEVN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |