Basic Information | |
---|---|
Taxon OID | 3300028804 Open in IMG/M |
Scaffold ID | Ga0268298_10217738 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1031 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands: Nijmegen, Gelderland | |||||||
Coordinates | Lat. (o) | 51.82 | Long. (o) | 5.87 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006851 | Metagenome | 363 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268298_102177383 | F006851 | GGA | MARTAKLDLRAFQQELATRLASKTAAQVESSRLGLAC |
⦗Top⦘ |